Protein profile

PA1219

hypothetical protein

Genome: NC_002516.2

Gene: PA1219 Structure source: AlphaFold UniProt Q9I4B9

Export view

Amino acids 204

Annotations 1

Features 6

PDB binders 0

Druggability 0.667

Overview

Basic information about this protein and its source genome.

Accession: PA1219
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1219
Status: annotated
Amino acids: 204
Structure source: AlphaFold

GO:0009058 A cellular process consisting of the biochemical pathways by which a living organism synthesizes chemical substances. This typically represents the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.667

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MLILLPDFIGHPSCFRGLLARLGATDCRLVDYHRLDAYASIEALASQVLDGLAEEPDWLIGYSFGGLVGYEMARQLPASRLLMIDSHLPWPALRRMPPSEQYQRWLSAEMREWIALMSELGELREEVLLRNVELFGRWQPRHRLARASWVRCRDDAGRDPAAERWCDLIERLDTFPCERPHHLALQDPAVIDFIVHTVSKESVQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0009058 A cellular process consisting of the biochemical pathways by which a living organism synthesizes chemical substances. This typically represents the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

Sequence Features

Domain/signature hits from InterPro and related databases.

6 records

Show feature table

Start	End	DB	Term	Name
2	86	Pfam	PF00975	Thioesterase domain
2	86	InterPro	IPR001031	Thioesterase
2	190	SUPERFAMILY	SSF53474	alpha/beta-Hydrolases
2	190	InterPro	IPR029058	Alpha/Beta hydrolase fold
1	200	Gene3D	G3DSA:3.40.50.1820	alpha/beta hydrolase
1	200	InterPro	IPR029058	Alpha/Beta hydrolase fold

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1219	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.667