Overview
Basic information about this protein and its source genome.
- Accession
- PA1219
- Gene
- PA1219
- Status
- annotated
- Amino acids
- 204
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLILLPDFIGHPSCFRGLLARLGATDCRLVDYHRLDAYASIEALASQVLDGLAEEPDWLIGYSFGGLVGYEMARQLPASRLLMIDSHLPWPALRRMPPSEQYQRWLSAEMREWIALMSELGELREEVLLRNVELFGRWQPRHRLARASWVRCRDDAGRDPAAERWCDLIERLDTFPCERPHHLALQDPAVIDFIVHTVSKESVQ
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0009058 A cellular process consisting of the biochemical pathways by which a living organism synthesizes chemical substances. This typically represents the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 86 | Pfam | PF00975 | Thioesterase domain |
| 2 | 86 | InterPro | IPR001031 | Thioesterase |
| 2 | 190 | SUPERFAMILY | SSF53474 | alpha/beta-Hydrolases |
| 2 | 190 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
| 1 | 200 | Gene3D | G3DSA:3.40.50.1820 | alpha/beta hydrolase |
| 1 | 200 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA1219
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.667 |