Protein profile

PA1235

transcriptional regulator

Genome: NC_002516.2

Gene: PA1235 Structure source: AlphaFold UniProt Q9I4A3
Amino acids 260
Annotations 5
Features 24
PDB binders 0
Druggability 0.743

Overview

Basic information about this protein and its source genome.

Accession
PA1235
Gene
PA1235
Status
annotated
Amino acids
260
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.743
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MLIDLPSTRPVFAYAQDYLHGERVELHRHSRAQLIHALSGVVTVGTAEGTWVVPPGRGVWLPAGIEHALRFAGQVRMRTLFIAPQARHDLPRDCRVVDVPPLLRQLIVAAMRIAPDYPPGGRDERVMELILDELRVLPILALHVPQPVDPRLAALCRSLRAEPAADWSLGDAARRLGVSPRTLTRAFQRETGLSFVQWLRRMRLLASLDALAAGHSILEVALDLGYDSQSAFSAMFRRTLGVSPSLYFGRGAAYGVAEGD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
  • GO:0009893 Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways within a cell or an organism.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
1 92 Gene3D G3DSA:2.60.120.10 Jelly Rolls
1 92 InterPro IPR014710 RmlC-like jelly roll fold
173 248 Pfam PF12833 Helix-turn-helix domain
173 248 InterPro IPR018060 DNA binding HTH domain, AraC-type
217 232 PRINTS PR00032 AraC bacterial regulatory protein HTH signature
217 232 InterPro IPR020449 Transcription regulator HTH, AraC- type
232 248 PRINTS PR00032 AraC bacterial regulatory protein HTH signature
232 248 InterPro IPR020449 Transcription regulator HTH, AraC- type
151 252 Gene3D G3DSA:1.10.10.60 -
147 251 FunFam G3DSA:1.10.10.60:FF:000132 AraC family transcriptional regulator
6 181 SUPERFAMILY SSF51182 RmlC-like cupins
6 181 InterPro IPR011051 RmlC-like cupin domain superfamily
166 248 SMART SM00342 aracneu4
166 248 InterPro IPR018060 DNA binding HTH domain, AraC-type
9 252 PANTHER PTHR11019 HTH-TYPE TRANSCRIPTIONAL REGULATOR NIMR
11 105 CDD cd06124 cupin_NimR-like_N
203 244 ProSitePatterns PS00041 Bacterial regulatory proteins, araC family signature.
203 244 InterPro IPR018062 HTH domain AraC-type, conserved site
203 248 SUPERFAMILY SSF46689 Homeodomain-like
203 248 InterPro IPR009057 Homeobox-like domain superfamily
153 250 ProSiteProfiles PS01124 Bacterial regulatory proteins, araC family DNA-binding domain profile.
153 250 InterPro IPR018060 DNA binding HTH domain, AraC-type
12 109 Pfam PF02311 AraC-like ligand binding domain
12 109 InterPro IPR003313 AraC-type arabinose-binding/dimerisation domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1235
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.743
1 0.697