Protein profile

PA1240

enoyl-CoA hydratase

Genome: NC_002516.2

Gene: PA1240 Structure source: Experimental + AlphaFold UniProt Q9I498
Amino acids 265
Annotations 3
Features 10
PDB binders 17
Druggability 0.599

Overview

Basic information about this protein and its source genome.

Accession
PA1240
Gene
PA1240
Status
annotated
Amino acids
265
Structure source
Experimental + AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
30.481
Human E-value
3.63e-12
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.599
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSEANSGPGRVTREQRGHLFLIGLDRAGKRNAFDSAMLADLALAMGEYERSEESRCAVLFAHGEHFTAGLDLMELAPKLAASGFRYPDGGVDPWGVVQPRRSKPLVVAVQGTCWTAGIELMLNADIAVAARGTRFAHLEVLRGIPPLGGSTVRFPRAAGWTDAMRYILTGDEFDADEALRMRLLTEVVEPGEELARALEYAERIARAAPLAVRAALQSAFQGRDEGDDAALSRVNESLAALIGSEDVREGVLAMVQKRAPAFKGR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0016829 Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
  • GO:0008203 The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
  • GO:0006635 A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).

Sequence Features

Domain/signature hits from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
9 207 FunFam G3DSA:3.90.226.10:FF:000042 Enoyl-CoA hydratase EchA1
10 265 SUPERFAMILY SSF52096 ClpP/crotonase
10 265 InterPro IPR029045 ClpP/crotonase-like domain superfamily
208 265 Gene3D G3DSA:1.10.12.10 -
208 265 InterPro IPR014748 Enoyl-CoA hydratase, C-terminal
19 264 Pfam PF00378 Enoyl-CoA hydratase/isomerase
19 264 InterPro IPR001753 Enoyl-CoA hydratase/isomerase
10 257 PANTHER PTHR43802 ENOYL-COA HYDRATASE
8 207 Gene3D G3DSA:3.90.226.10 -
11 204 CDD cd06558 crotonase-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

1 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 3LAO
X-ray 2.40 Å A,B,C
96.2% 1-255
Viewing
AlphaFold PA1240
AlphaFold full sequence Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
4 0.599
1 0.269

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 1.3 0.014

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

67 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2CP P52045 853.6 Da LogP -1.14 TPSA 383.9 3 viol. ✓ Clean C[C@@H](CSCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@@]…
BEZ A0A0H2ZTH2 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
CAA P14604 851.6 Da LogP -1.36 TPSA 380.7 3 viol. ✓ Clean CC(=O)CC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P…
CO8 P14604 893.7 Da LogP 1.03 TPSA 363.6 3 viol. ✓ Clean CCCCCCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P…
DAK P14604 940.8 Da LogP 0.44 TPSA 366.9 3 viol. Alert CC(C)(CO[P@](=O)(O)O[P@](=O)(O)OC[C@@H]1[C@H]([…
HXC P14604 865.7 Da LogP 0.25 TPSA 363.6 3 viol. ✓ Clean CCCCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@@…
KFV P52045 867.6 Da LogP -1.87 TPSA 412.8 3 viol. ✓ Clean CC(=[N+]([O-])[O-])C(=O)SCCNC(=O)CCNC(=O)[C@@H]…
KG7 P52045 103.1 Da LogP -0.08 TPSA 69.9 ✓ Ro5 ✓ Clean C/C(=N\O)/C(=O)O
KGA P52045 851.5 Da LogP -2.58 TPSA 422.0 3 viol. ✓ Clean CC(=[N+]([O-])[O-])C(=O)OCCNC(=O)CCNC(=O)[C@@H]…
KGJ P52045 850.5 Da LogP -3.01 TPSA 424.8 3 viol. ✓ Clean CC(=[N+]([O-])[O-])C(=O)NCCNC(=O)CCNC(=O)[C@@H]…
KGP P52045 886.6 Da LogP -3.20 TPSA 430.0 3 viol. ✓ Clean C[C@H](C(=O)NCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(…
LCV P52045 887.6 Da LogP -2.78 TPSA 427.2 3 viol. ✓ Clean C[C@@H](C(=O)OCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP…
MLI Q1D5Y4 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
SO5 P52045 887.6 Da LogP -2.78 TPSA 427.2 3 viol. ✓ Clean C[C@H](C(=O)OCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(…
YXR P52045 903.7 Da LogP -2.06 TPSA 418.0 3 viol. ✓ Clean C[C@H](C(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(…
YXS P52045 903.7 Da LogP -2.06 TPSA 418.0 3 viol. ✓ Clean C[C@@H](C(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP…
YZS P52045 886.6 Da LogP -3.20 TPSA 430.0 3 viol. ✓ Clean C[C@@H](C(=O)NCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.