Overview
Basic information about this protein and its source genome.
- Accession
- PA1240
- Gene
- PA1240
- Status
- annotated
- Amino acids
- 265
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- hit
- Human identity (%)
- 30.481
- Human E-value
- 3.63e-12
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSEANSGPGRVTREQRGHLFLIGLDRAGKRNAFDSAMLADLALAMGEYERSEESRCAVLFAHGEHFTAGLDLMELAPKLAASGFRYPDGGVDPWGVVQPRRSKPLVVAVQGTCWTAGIELMLNADIAVAARGTRFAHLEVLRGIPPLGGSTVRFPRAAGWTDAMRYILTGDEFDADEALRMRLLTEVVEPGEELARALEYAERIARAAPLAVRAALQSAFQGRDEGDDAALSRVNESLAALIGSEDVREGVLAMVQKRAPAFKGR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0016829 Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
- GO:0008203 The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
- GO:0006635 A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 9 | 207 | FunFam | G3DSA:3.90.226.10:FF:000042 | Enoyl-CoA hydratase EchA1 |
| 10 | 265 | SUPERFAMILY | SSF52096 | ClpP/crotonase |
| 10 | 265 | InterPro | IPR029045 | ClpP/crotonase-like domain superfamily |
| 208 | 265 | Gene3D | G3DSA:1.10.12.10 | - |
| 208 | 265 | InterPro | IPR014748 | Enoyl-CoA hydratase, C-terminal |
| 19 | 264 | Pfam | PF00378 | Enoyl-CoA hydratase/isomerase |
| 19 | 264 | InterPro | IPR001753 | Enoyl-CoA hydratase/isomerase |
| 10 | 257 | PANTHER | PTHR43802 | ENOYL-COA HYDRATASE |
| 8 | 207 | Gene3D | G3DSA:3.90.226.10 | - |
| 11 | 204 | CDD | cd06558 | crotonase-like |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
1 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 4 | 0.599 | ||||||
| 1 | 0.269 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 1.3 | 0.014 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.84 | ||||||
| 6 | 0.266 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 2CP | P52045 | 853.6 Da LogP -1.14 TPSA 383.9 | 3 viol. | ✓ Clean |
C[C@@H](CSCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@@]…
|
|
| BEZ | A0A0H2ZTH2 | 122.1 Da LogP 1.38 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)C(=O)O
|
|
| CAA | P14604 | 851.6 Da LogP -1.36 TPSA 380.7 | 3 viol. | ✓ Clean |
CC(=O)CC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P…
|
|
| CO8 | P14604 | 893.7 Da LogP 1.03 TPSA 363.6 | 3 viol. | ✓ Clean |
CCCCCCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P…
|
|
| DAK | P14604 | 940.8 Da LogP 0.44 TPSA 366.9 | 3 viol. | Alert |
CC(C)(CO[P@](=O)(O)O[P@](=O)(O)OC[C@@H]1[C@H]([…
|
|
| HXC | P14604 | 865.7 Da LogP 0.25 TPSA 363.6 | 3 viol. | ✓ Clean |
CCCCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@@…
|
|
| KFV | P52045 | 867.6 Da LogP -1.87 TPSA 412.8 | 3 viol. | ✓ Clean |
CC(=[N+]([O-])[O-])C(=O)SCCNC(=O)CCNC(=O)[C@@H]…
|
|
| KG7 | P52045 | 103.1 Da LogP -0.08 TPSA 69.9 | ✓ Ro5 | ✓ Clean |
C/C(=N\O)/C(=O)O
|
|
| KGA | P52045 | 851.5 Da LogP -2.58 TPSA 422.0 | 3 viol. | ✓ Clean |
CC(=[N+]([O-])[O-])C(=O)OCCNC(=O)CCNC(=O)[C@@H]…
|
|
| KGJ | P52045 | 850.5 Da LogP -3.01 TPSA 424.8 | 3 viol. | ✓ Clean |
CC(=[N+]([O-])[O-])C(=O)NCCNC(=O)CCNC(=O)[C@@H]…
|
|
| KGP | P52045 | 886.6 Da LogP -3.20 TPSA 430.0 | 3 viol. | ✓ Clean |
C[C@H](C(=O)NCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(…
|
|
| LCV | P52045 | 887.6 Da LogP -2.78 TPSA 427.2 | 3 viol. | ✓ Clean |
C[C@@H](C(=O)OCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP…
|
|
| MLI | Q1D5Y4 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| SO5 | P52045 | 887.6 Da LogP -2.78 TPSA 427.2 | 3 viol. | ✓ Clean |
C[C@H](C(=O)OCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(…
|
|
| YXR | P52045 | 903.7 Da LogP -2.06 TPSA 418.0 | 3 viol. | ✓ Clean |
C[C@H](C(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(…
|
|
| YXS | P52045 | 903.7 Da LogP -2.06 TPSA 418.0 | 3 viol. | ✓ Clean |
C[C@@H](C(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP…
|
|
| YZS | P52045 | 886.6 Da LogP -3.20 TPSA 430.0 | 3 viol. | ✓ Clean |
C[C@@H](C(=O)NCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC3269660 | 0.824 | 254.2 Da LogP 2.45 TPSA 71.4 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccccc2)cc1
|
| ZINC2504355 | 0.778 | 226.2 Da LogP 2.62 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccccc2)cc1
|
| ZINC1672966 | 0.688 | 210.2 Da LogP 2.75 TPSA 34.1 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccccc1)c1ccccc1
|
| ZINC34057267 | 0.684 | 274.3 Da LogP 4.72 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-c3ccccc3)cc2)cc1
|
| ZINC114185151 | 0.647 | 298.2 Da LogP 2.15 TPSA 108.7 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC1590838 | 0.647 | 342.4 Da LogP 3.82 TPSA 68.3 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(C(=O)C(=O)c2ccccc2)cc1)c1ccccc1
|
| ZINC16133932 | 0.647 | 474.5 Da LogP 4.88 TPSA 102.4 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(C(=O)C(=O)c2ccc(C(=O)C(=O)c3cccc…
|
| ZINC1070912 | 0.611 | 286.3 Da LogP 4.15 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)c1ccc(C(=O)c2ccccc2)cc1
|
| ZINC134079 | 0.611 | 242.2 Da LogP 2.75 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)cc2)cc1
|
| ZINC1640789 | 0.611 | 374.3 Da LogP 3.55 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)c3ccc(C(=O)O)cc3)cc…
|
| ZINC2146859 | 0.611 | 270.2 Da LogP 2.31 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC3147211 | 0.611 | 318.3 Da LogP 4.42 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-c3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC2539781 | 0.600 | 382.1 Da LogP 4.24 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)C(Br)(Br)C(=O)c1ccccc1
|
| ZINC100009533 | 0.591 | 226.2 Da LogP 3.80 TPSA 62.0 | ✓ Ro5 | Alert |
O=C(O)c1ccc(/N=N\c2ccccc2)cc1
|
| ZINC12956625 | 0.591 | 226.2 Da LogP 3.80 TPSA 62.0 | ✓ Ro5 | Alert |
O=C(O)c1ccc(N=Nc2ccccc2)cc1
|
| ZINC1601737 | 0.591 | 213.2 Da LogP 3.13 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Nc2ccccc2)cc1
|
| ZINC1689689 | 0.591 | 228.3 Da LogP 2.82 TPSA 61.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(NNc2ccccc2)cc1
|
| ZINC1697492 | 0.591 | 212.2 Da LogP 2.98 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Cc2ccccc2)cc1
|
| ZINC169818652 | 0.591 | 380.5 Da LogP 2.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([Si](c2ccccc2)(c2ccccc2)c2ccccc2)cc1
|
| ZINC33759110 | 0.591 | 224.3 Da LogP 3.56 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(/C=C/c2ccccc2)cc1
|
| ZINC346053 | 0.591 | 289.3 Da LogP 4.85 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(N(c2ccccc2)c2ccccc2)cc1
|
| ZINC396612 | 0.591 | 230.3 Da LogP 3.54 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Sc2ccccc2)cc1
|
| ZINC409186 | 0.591 | 226.2 Da LogP 2.62 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(C(=O)c2ccccc2)c1
|
| ZINC409394 | 0.591 | 226.3 Da LogP 3.17 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(CCc2ccccc2)cc1
|
| ZINC4299335 | 0.591 | 222.2 Da LogP 2.78 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C#Cc2ccccc2)cc1
|
| ZINC4403618 | 0.591 | 226.2 Da LogP 3.80 TPSA 62.0 | ✓ Ro5 | Alert |
O=C(O)c1ccc(/N=N/c2ccccc2)cc1
|
| ZINC4802802 | 0.591 | 288.3 Da LogP 4.57 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(c2ccccc2)c2ccccc2)cc1
|
| ZINC5538754 | 0.591 | 304.3 Da LogP 3.67 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(O)(c2ccccc2)c2ccccc2)cc1
|
| ZINC60939 | 0.591 | 214.2 Da LogP 3.18 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccccc2)cc1
|
| ZINC254583 | 0.583 | 242.2 Da LogP 2.60 TPSA 63.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(OC(=O)c2ccccc2)cc1
|
| ZINC43214128 | 0.583 | 240.3 Da LogP 2.81 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(CC(=O)c2ccccc2)cc1
|
| ZINC78349 | 0.583 | 241.2 Da LogP 2.64 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(NC(=O)c2ccccc2)cc1
|
| ZINC1718650 | 0.579 | 238.2 Da LogP 2.32 TPSA 51.2 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccccc1)C(=O)c1ccccc1
|
| ZINC4530702 | 0.579 | 224.3 Da LogP 3.14 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(CC(=O)c1ccccc1)c1ccccc1
|
| ZINC96315996 | 0.579 | 268.3 Da LogP 2.77 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C(=C(\C(=O)O)c1ccccc1)c1ccccc1
|
| ZINC1496851 | 0.571 | 260.2 Da LogP 3.39 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)C(F)(F)C(=O)c1ccccc1
|
| ZINC1602461 | 0.571 | 223.5 Da LogP 3.24 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)C(Cl)(Cl)Cl
|
| ZINC1726772 | 0.571 | 252.3 Da LogP 3.78 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(C)(C(=O)c1ccccc1)C(=O)c1ccccc1
|
| ZINC207916 | 0.571 | 270.2 Da LogP 2.31 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(C(=O)c2cccc(C(=O)O)c2)c1
|
| ZINC21298253 | 0.571 | 358.3 Da LogP 0.38 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)[C@@](O)(C(=O)c1ccccc1)[C@@](O)(C(=O)O)C(…
|
| ZINC21298260 | 0.571 | 358.3 Da LogP 0.38 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)[C@@](O)(C(=O)c1ccccc1)[C@](O)(C(=O)O)C(=…
|
| ZINC21298267 | 0.571 | 358.3 Da LogP 0.38 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)[C@](O)(C(=O)c1ccccc1)[C@](O)(C(=O)O)C(=O…
|
| ZINC3897007 | 0.571 | 242.2 Da LogP 2.75 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(-c2cccc(C(=O)O)c2)c1
|
| ZINC1670917 | 0.565 | 228.2 Da LogP 2.47 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([C@@H](O)c2ccccc2)cc1
|
| ZINC2043250 | 0.565 | 228.2 Da LogP 2.47 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([C@H](O)c2ccccc2)cc1
|
| ZINC289040 | 0.565 | 262.3 Da LogP 2.22 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(S(=O)(=O)c2ccccc2)cc1
|
| ZINC394370 | 0.565 | 270.2 Da LogP 2.31 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccccc2C(=O)O)cc1
|
| ZINC6624011 | 0.565 | 258.3 Da LogP 2.15 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([C@@H](O)[C@H](O)c2ccccc2)cc1
|
| ZINC6624012 | 0.565 | 258.3 Da LogP 2.15 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([C@H](O)[C@@H](O)c2ccccc2)cc1
|
| ZINC6624013 | 0.565 | 258.3 Da LogP 2.15 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([C@H](O)[C@H](O)c2ccccc2)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.