Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA1258
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1258
Status: annotated
Amino acids: 221
Structure source: AlphaFold

GO

GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter. GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0015184 Enables the transfer of L-cystine from one side of a membrane to the other. GO:0034589 The directed movement of hydroxyproline into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. GO:0015811 The directed movement of L-cystine (also known as dicysteine) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.767

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MFDYTFHWRSAFNALPEMLAGSLVTLQVTALSMLFGILIALLLAFARLGGNRPLRAAAGAWISIARNTPALFQIYILYFGLGSFGLHVSSWFALLAGVTFNNAGYLAETFRGGLQAVPETQLRAARSLGMSAPQAYRLVVIPQLLRVVFYPLTNQLVWAMLMTSLGVVVGLTDDLTGVTQALNVKTFRTFEYFALAAVLYFAMAKLLVLAARLLGWRLFRY

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

9 GO

Gene Ontology (GO)

9

GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0015184 Enables the transfer of L-cystine from one side of a membrane to the other.
GO:0034589 The directed movement of hydroxyproline into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
GO:0015811 The directed movement of L-cystine (also known as dicysteine) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
GO:0071705 The directed movement of nitrogen-containing compounds into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Sequence Features

Domain/signature hits from InterPro and related databases.

30 records

Show feature table

Start	End	DB	Term	Name
192	214	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
23	45	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
18	218	PANTHER	PTHR30614	MEMBRANE COMPONENT OF AMINO ACID ABC TRANSPORTER
18	218	InterPro	IPR043429	ABC transporter membrane protein permease protein ArtM/GltK/GlnP/TcyL/YhdX-like
36	211	Pfam	PF00528	Binding-protein-dependent transport system inner membrane component
36	211	InterPro	IPR000515	ABC transporter type 1, transmembrane domain MetI-like
149	171	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
4	219	FunFam	G3DSA:1.10.3720.10:FF:000127	Amino acid ABC transporter permease
192	215	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
147	172	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
84	107	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
74	96	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
216	221	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
47	57	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
4	219	Gene3D	G3DSA:1.10.3720.10	-
4	219	InterPro	IPR035906	MetI-like superfamily
17	204	SUPERFAMILY	SSF161098	MetI-like
17	204	InterPro	IPR035906	MetI-like superfamily
1	19	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
58	78	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
79	83	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
15	112	NCBIfam	TIGR01726	ABC transporter permease subunit, His/Glu/Gln/Arg/opine family, N-terminal region
15	112	InterPro	IPR010065	Amino acid ABC transporter, permease protein, 3-TM domain
23	203	CDD	cd06261	TM_PBP2
23	203	InterPro	IPR000515	ABC transporter type 1, transmembrane domain MetI-like
108	146	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
20	46	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
22	211	ProSiteProfiles	PS50928	ABC transporter integral membrane type-1 domain profile.
22	211	InterPro	IPR000515	ABC transporter type 1, transmembrane domain MetI-like
173	191	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1258	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
3				0.767
2				0.637
5				0.574
9				0.231

PA1258