Overview
Basic information about this protein and its source genome.
- Accession
- PA1258
- Gene
- PA1258
- Status
- annotated
- Amino acids
- 221
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MFDYTFHWRSAFNALPEMLAGSLVTLQVTALSMLFGILIALLLAFARLGGNRPLRAAAGAWISIARNTPALFQIYILYFGLGSFGLHVSSWFALLAGVTFNNAGYLAETFRGGLQAVPETQLRAARSLGMSAPQAYRLVVIPQLLRVVFYPLTNQLVWAMLMTSLGVVVGLTDDLTGVTQALNVKTFRTFEYFALAAVLYFAMAKLLVLAARLLGWRLFRY
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
9- GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015184 Enables the transfer of L-cystine from one side of a membrane to the other.
- GO:0034589 The directed movement of hydroxyproline into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0015811 The directed movement of L-cystine (also known as dicysteine) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0071705 The directed movement of nitrogen-containing compounds into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 192 | 214 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 23 | 45 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 18 | 218 | PANTHER | PTHR30614 | MEMBRANE COMPONENT OF AMINO ACID ABC TRANSPORTER |
| 18 | 218 | InterPro | IPR043429 | ABC transporter membrane protein permease protein ArtM/GltK/GlnP/TcyL/YhdX-like |
| 36 | 211 | Pfam | PF00528 | Binding-protein-dependent transport system inner membrane component |
| 36 | 211 | InterPro | IPR000515 | ABC transporter type 1, transmembrane domain MetI-like |
| 149 | 171 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 4 | 219 | FunFam | G3DSA:1.10.3720.10:FF:000127 | Amino acid ABC transporter permease |
| 192 | 215 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 147 | 172 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 84 | 107 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 74 | 96 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 216 | 221 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 47 | 57 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 4 | 219 | Gene3D | G3DSA:1.10.3720.10 | - |
| 4 | 219 | InterPro | IPR035906 | MetI-like superfamily |
| 17 | 204 | SUPERFAMILY | SSF161098 | MetI-like |
| 17 | 204 | InterPro | IPR035906 | MetI-like superfamily |
| 1 | 19 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 58 | 78 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 79 | 83 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 15 | 112 | NCBIfam | TIGR01726 | ABC transporter permease subunit, His/Glu/Gln/Arg/opine family, N-terminal region |
| 15 | 112 | InterPro | IPR010065 | Amino acid ABC transporter, permease protein, 3-TM domain |
| 23 | 203 | CDD | cd06261 | TM_PBP2 |
| 23 | 203 | InterPro | IPR000515 | ABC transporter type 1, transmembrane domain MetI-like |
| 108 | 146 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 20 | 46 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 22 | 211 | ProSiteProfiles | PS50928 | ABC transporter integral membrane type-1 domain profile. |
| 22 | 211 | InterPro | IPR000515 | ABC transporter type 1, transmembrane domain MetI-like |
| 173 | 191 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA1258
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 3 | 0.767 | ||||||
| 2 | 0.637 | ||||||
| 5 | 0.574 | ||||||
| 9 | 0.231 |