Overview
Basic information about this protein and its source genome.
- Accession
- PA1356
- Gene
- PA1356
- Status
- annotated
- Amino acids
- 368
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSERLYVGTRKGLFELRRNAAGQWLPMASHFLGEPLSMLLADPRDGALYAALNLGHFGVKLWRRDAGATDWMECAVPVYPPQPPAAEPLEGQAAEPPWSLQQLWILEPGGADRPGTLWAGTIPGGLFRSDDRGASWRLNRELWERPERAQWFGGGYDHPGIHSICVDPRDSRHLTVAVSCGGVWQSHDDGRSWTCTTKGMRADYMPPEQSEEAAIQDPHRLVQCQARPEFLWVQHHNGIFRSRDGGLHWQGVVAEPSSFGFAVAVHPRQPDTAWFVPATKDECRIPRDARFVVTRTRDGGRSFETLERGLPDGPAYDLVYRHGLDIDPSGERLAMGSTTGGLWLSENGGEDWQQLSANLPPIYCVRFA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0010411 The chemical reactions and pathways involving xyloglucan, the cross-linking glycan composed of (1->4)-beta-D-glucan backbone substituted at regular intervals with beta-D-xylosyl-(1->6) residues, which is present in the primary cell wall of most higher plants.
- GO:0005515 Binding to a protein.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 126 | 316 | CDD | cd15482 | Sialidase_non-viral |
| 1 | 368 | Gene3D | G3DSA:2.130.10.10 | - |
| 1 | 368 | InterPro | IPR015943 | WD40/YVTN repeat-like-containing domain superfamily |
| 2 | 353 | SUPERFAMILY | SSF110296 | Oligoxyloglucan reducing end-specific cellobiohydrolase |
| 1 | 292 | PANTHER | PTHR43739 | XYLOGLUCANASE (EUROFUNG) |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA1356
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 4 | 0.596 | ||||||
| 2 | 0.532 | ||||||
| 1 | 0.526 |