Protein profile

PA1356

hypothetical protein

Genome: NC_002516.2

Gene: PA1356 Structure source: AlphaFold UniProt Q9I3Y8

Export view

Amino acids 368

Annotations 2

Features 5

PDB binders 0

Druggability 0.596

Overview

Basic information about this protein and its source genome.

Accession: PA1356
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1356
Status: annotated
Amino acids: 368
Structure source: AlphaFold

GO:0010411 The chemical reactions and pathways involving xyloglucan, the cross-linking glycan composed of (1->4)-beta-D-glucan backbone substituted at regular intervals with beta-D-xylosyl-(1->6) residues, which is present in the primary cell wall of most higher plants. GO:0005515 Binding to a protein.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.596

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSERLYVGTRKGLFELRRNAAGQWLPMASHFLGEPLSMLLADPRDGALYAALNLGHFGVKLWRRDAGATDWMECAVPVYPPQPPAAEPLEGQAAEPPWSLQQLWILEPGGADRPGTLWAGTIPGGLFRSDDRGASWRLNRELWERPERAQWFGGGYDHPGIHSICVDPRDSRHLTVAVSCGGVWQSHDDGRSWTCTTKGMRADYMPPEQSEEAAIQDPHRLVQCQARPEFLWVQHHNGIFRSRDGGLHWQGVVAEPSSFGFAVAVHPRQPDTAWFVPATKDECRIPRDARFVVTRTRDGGRSFETLERGLPDGPAYDLVYRHGLDIDPSGERLAMGSTTGGLWLSENGGEDWQQLSANLPPIYCVRFA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

GO:0010411 The chemical reactions and pathways involving xyloglucan, the cross-linking glycan composed of (1->4)-beta-D-glucan backbone substituted at regular intervals with beta-D-xylosyl-(1->6) residues, which is present in the primary cell wall of most higher plants.
GO:0005515 Binding to a protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

5 records

Show feature table

Start	End	DB	Term	Name
126	316	CDD	cd15482	Sialidase_non-viral
1	368	Gene3D	G3DSA:2.130.10.10	-
1	368	InterPro	IPR015943	WD40/YVTN repeat-like-containing domain superfamily
2	353	SUPERFAMILY	SSF110296	Oligoxyloglucan reducing end-specific cellobiohydrolase
1	292	PANTHER	PTHR43739	XYLOGLUCANASE (EUROFUNG)

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1356	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
4				0.596
2				0.532
1				0.526