Protein profile

PA1432

acyl-homoserine-lactone synthase

Genome: NC_002516.2

Gene: lasI PA1432 Structure source: Experimental + AlphaFold UniProt P33883
Export view
Amino acids 201
Annotations 5
Features 19
PDB binders 3
Druggability 0.641

Overview

Basic information about this protein and its source genome.

Accession
PA1432
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
lasI PA1432
Status
annotated
Amino acids
201
Structure source
Experimental + AlphaFold
EC
2.3.1.184
GO
GO:0061579 Catalysis of the reaction: a fatty acyl-[ACP] + S-adenosyl-L-methionine = an N-acyl-L-homoserine lactone + S-methyl-5'-thioadenosine + holo-[ACP] + H+. GO:0009372 The cell-cell signaling process in which single-celled organisms carry out coordinated responses by monitoring their own population density, and often also that of other microbes, by producing small, diffusible, signal molecules, detecting the concentration of these molecules, and triggering a signal transduction pathway when a certain threshold is reached. Quorum sensing can occur amongst microbial communities in the environment or within host organisms. GO:0007165 The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell. GO:0016740 Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.641
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDTPEAQVFGCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQRLAVS

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0061579 Catalysis of the reaction: a fatty acyl-[ACP] + S-adenosyl-L-methionine = an N-acyl-L-homoserine lactone + S-methyl-5'-thioadenosine + holo-[ACP] + H+.
  • GO:0009372 The cell-cell signaling process in which single-celled organisms carry out coordinated responses by monitoring their own population density, and often also that of other microbes, by producing small, diffusible, signal molecules, detecting the concentration of these molecules, and triggering a signal transduction pathway when a certain threshold is reached. Quorum sensing can occur amongst microbial communities in the environment or within host organisms.
  • GO:0007165 The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
  • GO:0016740 Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
13 184 Pfam PF00765 Autoinducer synthase
13 184 InterPro IPR001690 Autoinducer synthase
7 191 SUPERFAMILY SSF55729 Acyl-CoA N-acyltransferases (Nat)
7 191 InterPro IPR016181 Acyl-CoA N-acyltransferase
97 109 PRINTS PR01549 Autoinducer synthesis protein signature
97 109 InterPro IPR001690 Autoinducer synthase
18 37 PRINTS PR01549 Autoinducer synthesis protein signature
18 37 InterPro IPR001690 Autoinducer synthase
142 163 PRINTS PR01549 Autoinducer synthesis protein signature
142 163 InterPro IPR001690 Autoinducer synthase
64 82 PRINTS PR01549 Autoinducer synthesis protein signature
64 82 InterPro IPR001690 Autoinducer synthase
1 192 PANTHER PTHR39322 ACYL-HOMOSERINE-LACTONE SYNTHASE
1 192 InterPro IPR001690 Autoinducer synthase
22 47 ProSitePatterns PS00949 Autoinducer synthase family signature.
22 47 InterPro IPR018311 Autoinducer synthesis, conserved site
1 189 ProSiteProfiles PS51187 Autoinducer synthase family profile.
1 189 InterPro IPR001690 Autoinducer synthase
1 190 Gene3D G3DSA:3.40.630.30 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

1 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 1RO5
X-ray 2.30 Å A
100.0% 1-201
PDBe RCSB PDBj File
Viewing
AlphaFold PA1432
AlphaFold — — full sequence — Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.641
3 0.416
1 0.206

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 9.54 0.513
2 6.63 0.336
3 2.8 0.086

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
MTA
3P2H
Q4VSJ8 297.3 Da LogP -0.61 TPSA 119.3 ✓ Ro5 ✓ Clean CSC[C@@H]1[C@H]([C@H]([C@@H](O1)n2cnc3c2ncnc3N)…
NOO
3P2H
Q4VSJ8 237.3 Da LogP 3.10 TPSA 46.2 ✓ Ro5 ✓ Clean CCCCCCCC(=O)NC1=CC(=O)CCC1
REO
1K4J
P54656 250.2 Da LogP -1.55 TPSA 74.3 ✓ Ro5 ✓ Clean [O-][Re](=O)(=O)=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.