Overview
Basic information about this protein and its source genome.
- Accession
- PA1479
- Gene
- PA1479 cycJ ccmE
- Status
- annotated
- Amino acids
- 162
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNPVRKKRLIIVLAIVAGVGAAVGLALSALQQNINLFYTPTQIANGEAPTDTRIRAGGLVEKGSLQRSEDSLNVRFVVTDGAKEVTIAYHGILPDLFREGQGIVALGKLGGDGVLVADEVLAKHDENYMPPEVTKALKDSGQLKHYENGKAAGETSYNQEGK
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
- GO:0046872 Binding to a metal ion.
- GO:1903607 The chemical reactions and pathways resulting in the formation of cytochrome c.
- GO:0017004 The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.
- GO:0017003 The covalent linkage of heme and a protein.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 21 | 28 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 29 | 162 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 139 | 162 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 30 | 137 | SUPERFAMILY | SSF82093 | Heme chaperone CcmE |
| 30 | 137 | InterPro | IPR036127 | CcmE-like superfamily |
| 9 | 20 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 21 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 1 | 8 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 5 | 131 | Pfam | PF03100 | CcmE |
| 5 | 131 | InterPro | IPR004329 | CcmE/CycJ protein |
| 30 | 137 | Gene3D | G3DSA:2.40.50.140 | - |
| 30 | 137 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 9 | 31 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 2 | 141 | Hamap | MF_01959 | Cytochrome c-type biogenesis protein CcmE [ccmE]. |
| 2 | 141 | InterPro | IPR004329 | CcmE/CycJ protein |
| 1 | 28 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 30 | 137 | FunFam | G3DSA:2.40.50.140:FF:000104 | Cytochrome c-type biogenesis protein CcmE |
| 3 | 155 | PANTHER | PTHR34128 | CYTOCHROME C-TYPE BIOGENESIS PROTEIN CCME HOMOLOG, MITOCHONDRIAL |
| 3 | 155 | InterPro | IPR004329 | CcmE/CycJ protein |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA1479
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.73 |