Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA1479
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1479 cycJ ccmE
Status: annotated
Amino acids: 162
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring. GO:0046872 Binding to a metal ion. GO:1903607 The chemical reactions and pathways resulting in the formation of cytochrome c. GO:0017004 The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions. GO:0017003 The covalent linkage of heme and a protein.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.73

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MNPVRKKRLIIVLAIVAGVGAAVGLALSALQQNINLFYTPTQIANGEAPTDTRIRAGGLVEKGSLQRSEDSLNVRFVVTDGAKEVTIAYHGILPDLFREGQGIVALGKLGGDGVLVADEVLAKHDENYMPPEVTKALKDSGQLKHYENGKAAGETSYNQEGK

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
GO:0046872 Binding to a metal ion.
GO:1903607 The chemical reactions and pathways resulting in the formation of cytochrome c.
GO:0017004 The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.
GO:0017003 The covalent linkage of heme and a protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records

Show feature table

Start	End	DB	Term	Name
21	28	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
29	162	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
139	162	MobiDBLite	mobidb-lite	consensus disorder prediction
30	137	SUPERFAMILY	SSF82093	Heme chaperone CcmE
30	137	InterPro	IPR036127	CcmE-like superfamily
9	20	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
1	21	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
1	8	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
5	131	Pfam	PF03100	CcmE
5	131	InterPro	IPR004329	CcmE/CycJ protein
30	137	Gene3D	G3DSA:2.40.50.140	-
30	137	InterPro	IPR012340	Nucleic acid-binding, OB-fold
9	31	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
2	141	Hamap	MF_01959	Cytochrome c-type biogenesis protein CcmE [ccmE].
2	141	InterPro	IPR004329	CcmE/CycJ protein
1	28	Phobius	SIGNAL_PEPTIDE	Signal peptide region
30	137	FunFam	G3DSA:2.40.50.140:FF:000104	Cytochrome c-type biogenesis protein CcmE
3	155	PANTHER	PTHR34128	CYTOCHROME C-TYPE BIOGENESIS PROTEIN CCME HOMOLOG, MITOCHONDRIAL
3	155	InterPro	IPR004329	CcmE/CycJ protein

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1479	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.73

PA1479