Protein target profile

PA1483a

hypothetical protein

Genome: NC_002516.2

Gene: YP_008719744.1 3D evidence: ColabFold model
Export view
Length 138
Pocket druggability 0.696
EC / GO 0 / 0
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

2 signals

Strengths

Moderate predicted binding pocket FPocket selected-pocket score 0.70. This supports review but is not experimental validation. Structure available ColabFold model

Risks / watch

Human similarity Top human hit identity: 48.214%.

Missing evidence

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA1483a
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
YP_008719744.1
Status
annotated
Amino acids
138
3D evidence
ColabFold model

Target profile

Computed evidence for target prioritization.

Human off-target
Hit
Human identity (%)
48.214
Human E-value
5.57e-06
Gut microbiome off-target
Hit
Essential (DEG)
N
Localization
Unknown

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.696
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MKAKYLGLAILLGGLGGCVVHPPQTSEPPASLPPQSQPQPGPSSAPGATPPRITPQPQTPAQPSRSRPQFAPPPGGKGVWDGSLGVYVIRGERDLYYRQRTYYRWDGGWFWSTSPQGPWTETDARGIPPGLSRRYANP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
6 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 20 SignalP_EUK SignalP-noTM SignalP-noTM
21 138 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 25 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
16 20 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 18 ProSiteProfiles PS51257 Prokaryotic membrane lipoprotein lipid attachment site profile.
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
114 138 MobiDBLite mobidb-lite consensus disorder prediction
26 70 MobiDBLite mobidb-lite consensus disorder prediction
19 83 MobiDBLite mobidb-lite consensus disorder prediction
1 20 Phobius SIGNAL_PEPTIDE Signal peptide region

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
ColabFold PA1483A
ColabFold — — full sequence — Viewing
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.696
Show in viewer