Protein profile

PA1600

cytochrome C

Genome: NC_002516.2

Gene: PA1600 Structure source: AlphaFold UniProt Q9I3C1
Export view
Amino acids 433
Annotations 6
Features 32
PDB binders 0
Druggability 0.704

Overview

Basic information about this protein and its source genome.

Accession
PA1600
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA1600
Status
annotated
Amino acids
433
Structure source
AlphaFold
GO
GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways. GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring. GO:0005506 Binding to an iron (Fe) ion. GO:0016614 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.704
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MKKATRIGLWASGSLVALAAIALGYAWQPAIAPLEGTPGPFSAEQIARGERLAALGDCAVCHTREGGPRNAGGRALPTPFGTIYSSNLTPDRASGIGGWSYPAFERAMRHGVARDGSYLYPAFPYTAFTRTRDEDLKALYAYLMSQPAVHSETPANQLPFPFDQRQLMAGWNLLFLDPGAYRDEPTRNQQWNRGAYLAEGLGHCSACHSPRNALGAEKSGSAHFAGGEAEGWTAPALNASSPAPIAWSEEALYAYLRHGYSAYHGVASGPMAPVVGEGLAKQPDEDLRALAHYLASYAAAPAGETDQQQAQRLDRQGYGRVQPPSGSGARLFAGACLACHHDGDGPRFFGVRPSLALNSNVHADSPDNLLRIILDGIHSPATGDLGYMPGFRHSLDDRQVATLANYLRERFAGKPAWPDLAAKAASLRRQAAP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
  • GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
  • GO:0005506 Binding to an iron (Fe) ion.
  • GO:0016614 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

32 records
Show feature table
Start End DB Term Name
7 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
189 298 ProSiteProfiles PS51007 Cytochrome c family profile.
189 298 InterPro IPR009056 Cytochrome c-like domain
44 147 ProSiteProfiles PS51007 Cytochrome c family profile.
44 147 InterPro IPR009056 Cytochrome c-like domain
19 431 PANTHER PTHR35008 BLL4482 PROTEIN-RELATED
1 19 SignalP_GRAM_NEGATIVE SignalP-TM SignalP-TM
27 433 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 157 Gene3D G3DSA:1.10.760.10 -
1 157 InterPro IPR036909 Cytochrome c-like domain superfamily
1 6 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
181 306 Gene3D G3DSA:1.10.760.10 -
181 306 InterPro IPR036909 Cytochrome c-like domain superfamily
14 433 PIRSF PIRSF000018 Mb_ADH_cytochrome_c
14 433 InterPro IPR014353 Membrane-bound alcohol dehydrogenase, cytochrome c subunit
327 407 Pfam PF13442 Cytochrome C oxidase, cbb3-type, subunit III
327 407 InterPro IPR009056 Cytochrome c-like domain
1 26 Phobius SIGNAL_PEPTIDE Signal peptide region
323 411 ProSiteProfiles PS51007 Cytochrome c family profile.
323 411 InterPro IPR009056 Cytochrome c-like domain
190 296 SUPERFAMILY SSF46626 Cytochrome c
190 296 InterPro IPR036909 Cytochrome c-like domain superfamily
318 433 Gene3D G3DSA:1.10.760.10 -
318 433 InterPro IPR036909 Cytochrome c-like domain superfamily
38 168 SUPERFAMILY SSF46626 Cytochrome c
38 168 InterPro IPR036909 Cytochrome c-like domain superfamily
19 26 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
327 419 SUPERFAMILY SSF46626 Cytochrome c
327 419 InterPro IPR036909 Cytochrome c-like domain superfamily
7 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
46 146 Pfam PF00034 Cytochrome c
46 146 InterPro IPR009056 Cytochrome c-like domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1600
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.704
2 0.69