Overview
Basic information about this protein and its source genome.
- Accession
- PA1657
- Gene
- PA1657
- Status
- annotated
- Amino acids
- 168
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRADERKVEDRKPIGIDKMTFDEVLAKQELGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKAIESVLADDESRSRVLGELGLSAAPSQDA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0033103 The process in which proteins are transferred into the extracellular milieu or directly into host cells by the type VI secretion system. Proteins secreted by this system do not require an N-terminal signal sequence.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 164 | PANTHER | PTHR35850 | CYTOPLASMIC PROTEIN-RELATED |
| 2 | 164 | InterPro | IPR008312 | Type VI secretion system sheath protein TssB1 |
| 6 | 158 | Pfam | PF05591 | Type VI secretion system, VipA, VC_A0107 or Hcp2 |
| 6 | 158 | InterPro | IPR008312 | Type VI secretion system sheath protein TssB1 |
| 3 | 158 | NCBIfam | TIGR03358 | type VI secretion system contractile sheath small subunit |
| 3 | 158 | InterPro | IPR008312 | Type VI secretion system sheath protein TssB1 |
| 1 | 168 | PIRSF | PIRSF028301 | UCP028301 |
| 1 | 168 | InterPro | IPR008312 | Type VI secretion system sheath protein TssB1 |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA1657
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.764 |