Overview
Basic information about this protein and its source genome.
- Accession
- PA1666
- Gene
- PA1666
- Status
- annotated
- Amino acids
- 168
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAKELTRVELKLGQKGILNAGELLGKAGDAR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0033103 The process in which proteins are transferred into the extracellular milieu or directly into host cells by the type VI secretion system. Proteins secreted by this system do not require an N-terminal signal sequence.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 34 | 151 | Pfam | PF12790 | Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113 |
| 34 | 151 | InterPro | IPR017734 | Type VI secretion system, lipoprotein SciN |
| 1 | 13 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 1 | 10 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 24 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. |
| 27 | 168 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 26 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 30 | 158 | Gene3D | G3DSA:2.60.40.4150 | Type VI secretion system, lipoprotein SciN |
| 30 | 158 | InterPro | IPR038706 | Type VI secretion protein SciN-like superfamily |
| 1 | 26 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 22 | 26 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 12 | 31 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 157 | PANTHER | PTHR37625 | OUTER MEMBRANE LIPOPROTEIN-RELATED |
| 1 | 157 | InterPro | IPR017734 | Type VI secretion system, lipoprotein SciN |
| 11 | 21 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 10 | 154 | NCBIfam | TIGR03352 | type VI secretion system lipoprotein TssJ |
| 10 | 154 | InterPro | IPR017734 | Type VI secretion system, lipoprotein SciN |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA1666
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.77 | ||||||
| 1 | 0.211 |