Protein profile

PA1671

serine-threonine kinase Stk1

Genome: NC_002516.2

Gene: PA1671 stk1 Structure source: AlphaFold UniProt Q9I354
Amino acids 329
Annotations 4
Features 15
PDB binders 3
Druggability 0.693

Overview

Basic information about this protein and its source genome.

Accession
PA1671
Gene
PA1671 stk1
Status
annotated
Amino acids
329
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
35.714
Human E-value
1.91e-15
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.693
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARDLLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMPGLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGILDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQLRAPRHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0004672 Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
  • GO:0033103 The process in which proteins are transferred into the extracellular milieu or directly into host cells by the type VI secretion system. Proteins secreted by this system do not require an N-terminal signal sequence.
  • GO:0006468 The process of introducing a phosphate group on to a protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
142 322 Gene3D G3DSA:1.10.510.10 Transferase(Phosphotransferase) domain 1
49 305 PANTHER PTHR43671 SERINE/THREONINE-PROTEIN KINASE NEK
15 141 Gene3D G3DSA:3.30.200.20 Phosphorylase Kinase; domain 1
39 307 SUPERFAMILY SSF56112 Protein kinase-like (PK-like)
39 307 InterPro IPR011009 Protein kinase-like domain superfamily
51 323 SMART SM00220 serkin_6
51 323 InterPro IPR000719 Protein kinase domain
179 191 ProSitePatterns PS00108 Serine/Threonine protein kinases active-site signature.
179 191 InterPro IPR008271 Serine/threonine-protein kinase, active site
51 305 Pfam PF00069 Protein kinase domain
51 305 InterPro IPR000719 Protein kinase domain
51 323 ProSiteProfiles PS50011 Protein kinase domain profile.
50 316 CDD cd14014 STKc_PknB_like
57 86 ProSitePatterns PS00107 Protein kinases ATP-binding region signature.
57 86 InterPro IPR017441 Protein kinase, ATP binding site

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1671
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.693
1 0.378

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

153 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
0BD P9WI83 468.5 Da LogP -1.91 TPSA 178.5 2 viol. ✓ Clean CC(C)CC(CC(C)C)O[C@H]1[C@@H]([C@H]([C@@H]([C@H]…
5RC Q96L34 473.5 Da LogP 4.28 TPSA 85.3 ✓ Ro5 ✓ Clean CCc1c(cc(s1)C(=O)N[C@@H]2[C@@H](CCCC2(F)F)N)c3c…
F8Z Q9UQB9 590.7 Da LogP 4.42 TPSA 121.8 1 viol. ✓ Clean C[C@H]1CN(C(=O)c2cc(ccc2O[C@H]1CN(C)Cc3ccc4c(c3…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.