Protein profile

PA1824

hypothetical protein

Genome: NC_002516.2

Gene: PA1824 Structure source: AlphaFold UniProt Q9I2S1
Amino acids 259
Annotations 2
Features 24
PDB binders 0
Druggability 0.745

Overview

Basic information about this protein and its source genome.

Accession
PA1824
Gene
PA1824
Status
annotated
Amino acids
259
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.745
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MPFELAIDPSTLIILAVVAFLAGFIDAIAGGGGLLTIPALLTAGVPPHLALGTNKLSSTFGAATASYTFYRRKLFHPGKWRNGLLATAIGAAIGAWAAHLLPAEWLNRMLPVVVFTCGLYMLFGGTPKAPLDADAPLGRKRQWPQGLALGFYDGVAGPGTGAFWTVSSLLMYPLDLVRASGVARSMNFVSNIVALAVFIASGQVIWLLGLCMGASLMVGAYFGARTAIGGGAKFIRPVFILVVLALTARLAWQHWFSGA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
105 125 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
100 104 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
38 48 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
188 210 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
80 99 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 249 Pfam PF01925 Sulfite exporter TauE/SafE
15 249 InterPro IPR002781 Transmembrane protein TauE-like
223 233 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
109 126 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
49 70 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
12 37 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
192 222 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
126 145 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
71 81 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
82 99 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
146 168 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
13 35 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
146 172 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
234 256 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
234 252 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
7 257 PANTHER PTHR30269 TRANSMEMBRANE PROTEIN YFCA
173 191 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
253 259 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1824
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
3 0.745
1 0.603