Protein profile

PA1829

hypothetical protein

Genome: NC_002516.2

Gene: PA1829 Structure source: AlphaFold UniProt Q9I2R6

Export view

Amino acids 356

Annotations 0

Features 10

PDB binders 0

Druggability 0.735

Overview

Basic information about this protein and its source genome.

Accession: PA1829
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1829
Status: annotated
Amino acids: 356
Structure source: AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target: hit
Human identity (%): 38.346
Human E-value: 6e-17
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.735

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSLTDQSTRIRAGEELDAAVIDPYLKAHIPGLEGTPKISQFPGGASNLTYLIEYPRQEFVLRRPPFGHKAKSAHDMGREYRILNQLNAGFPYCPKAYLYCTDESVIGAEFYVMERVKGIILRAELPPELNLDEQQTRSLCKSFIDKFVELHNVDYAACGLADLGRPDGYVQRQIAGWTDRYEKALTPDAPLWEPVKAWLKDKQPADHHKPGIVHNDYRFDNVILDPENPMQIIGVLDWELATLGDPLMDLGNTLAYWVEAGDPAPVQLTRRQPSHLPGMLTRREFADYYAERAGIPPIDNLDFYYTYGLFRLAGIVQQIYYRYYHGQTQDKRFAQFVQMNKLLEQMSLQAIERSRL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

10 records

Show feature table

Start	End	DB	Term	Name
15	116	Gene3D	G3DSA:3.30.200.20	Phosphorylase Kinase; domain 1
118	356	Gene3D	G3DSA:3.90.1200.10	-
38	293	CDD	cd05154	ACAD10_11_N-like
38	293	InterPro	IPR041726	Acyl-CoA dehydrogenase family member 10/11, N-terminal
38	275	Pfam	PF01636	Phosphotransferase enzyme family
38	275	InterPro	IPR002575	Aminoglycoside phosphotransferase
18	340	SUPERFAMILY	SSF56112	Protein kinase-like (PK-like)
18	340	InterPro	IPR011009	Protein kinase-like domain superfamily
34	347	PANTHER	PTHR47829	HYDROLASE, PUTATIVE (AFU_ORTHOLOGUE AFUA_1G12880)-RELATED
15	116	FunFam	G3DSA:3.30.200.20:FF:000500	Putative aminoglycoside phosphotransferase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1829	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.735
6				0.735