Protein profile

PA1836

transcriptional regulator

Genome: NC_002516.2

Gene: PA1836 Structure source: Experimental + AlphaFold UniProt Q9I2Q9
Export view
Amino acids 193
Annotations 4
Features 21
PDB binders 2
Druggability 0.753

Overview

Basic information about this protein and its source genome.

Accession
PA1836
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA1836
Status
annotated
Amino acids
193
Structure source
Experimental + AlphaFold
GO
GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.753
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MGRSSRKDEILQAALACFSEHGVDATTIEMIRDRSGASIGSLYHHFGNKERIHGELYLAGIGQYAALLEAGFARARSAEETVRLLVTSYIDWVVANPDWARFILHSRGRVEAGELGERLRADNQAHFARIHAALAGYRAEGLFREMPDDCFASVVIGPAHDLARQWLAGRTRVALADCRELLAQVAWDSVRAA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Sequence Features

Domain/signature hits from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
4 64 ProSiteProfiles PS50977 TetR-type HTH domain profile.
4 64 InterPro IPR001647 DNA-binding HTH domain, TetR-type
3 192 PANTHER PTHR30055 HTH-TYPE TRANSCRIPTIONAL REGULATOR RUTR
19 25 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
26 193 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
22 52 ProSitePatterns PS01081 TetR-type HTH domain signature.
22 52 InterPro IPR023772 DNA-binding HTH domain, TetR-type, conserved site
10 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
77 191 SUPERFAMILY SSF48498 Tetracyclin repressor-like, C-terminal domain
77 191 InterPro IPR036271 Tetracyclin repressor-like, C-terminal domain superfamily
1 9 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
3 80 SUPERFAMILY SSF46689 Homeodomain-like
3 80 InterPro IPR009057 Homeobox-like domain superfamily
1 193 Gene3D G3DSA:1.10.357.10 Tetracycline Repressor, domain 2
10 52 Pfam PF00440 Bacterial regulatory proteins, tetR family
10 52 InterPro IPR001647 DNA-binding HTH domain, TetR-type
10 23 PRINTS PR00455 TetR bacterial regulatory protein HTH signature
10 23 InterPro IPR001647 DNA-binding HTH domain, TetR-type
31 54 PRINTS PR00455 TetR bacterial regulatory protein HTH signature
31 54 InterPro IPR001647 DNA-binding HTH domain, TetR-type
1 25 Phobius SIGNAL_PEPTIDE Signal peptide region

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

1 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 2GEN
X-ray 1.70 Å A
100.0% 1-193
PDBe RCSB PDBj File
Viewing
AlphaFold PA1836
AlphaFold — — full sequence — Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.753

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 22.95 0.885
2 1.37 0.016

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

6 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
DCC
1VI0
P94548 949.8 Da LogP 2.59 TPSA 363.6 3 viol. ✓ Clean CCCCCCCCCCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)…
ST9
3WHC
P94548 1034.0 Da LogP 4.93 TPSA 363.6 3 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.