Protein profile

PA1863

molybdenum ABC transporter substrate-binding protein ModA

Genome: NC_002516.2

Gene: PA1863 modA Structure source: Experimental + AlphaFold UniProt Q9I2N2
Amino acids 251
Annotations 5
Features 19
PDB binders 5
Druggability 0.651

Overview

Basic information about this protein and its source genome.

Accession
PA1863
Gene
PA1863 modA
Status
annotated
Amino acids
251
Structure source
Experimental + AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.651
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTTRLPQLLLALLASAVSLAASADEVQVAVAANFTAPIQAIAKEFEKDTGHRLVAAYGATGQFYTQIKNGAPFQVFLSADDSTPAKLEQEGEVVPGSRFTYAIGTLALWSPKAGYVDAEGEVLKSGSFRHLSIANPKTAPYGLAATQAMDKLGLAATLGPKLVEGQNISQAYQFVSSGNAELGFVALSQIYKDGKVATGSAWIVPTELHDPIRQDAVILNKGKDNAAAKALVDYLKGAKAAALIKSYGYEL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
  • GO:0046872 Binding to a metal ion.
  • GO:0030973 Binding to a molybdate ion (MoO4 2-).
  • GO:1901359 Binding to tungstate.
  • GO:0015689 The directed movement of molybdate (MoO4 2-) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Molybdate is the bivalent anion derived from molybdic acid.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
1 7 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
104 212 FunFam G3DSA:3.40.190.10:FF:000035 Molybdate ABC transporter substrate-binding protein
25 250 CDD cd13539 PBP2_AvModA
25 250 InterPro IPR044084 AvModA-like, substrate binding domain
1 23 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
1 23 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
30 249 Gene3D G3DSA:3.40.190.10 -
14 250 PANTHER PTHR30632 MOLYBDATE-BINDING PERIPLASMIC PROTEIN
26 250 Pfam PF13531 Bacterial extracellular solute-binding protein
25 250 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
1 251 PIRSF PIRSF004846 ModA
1 251 InterPro IPR005950 Molybdate ABC transporter, substrate-binding protein
24 251 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
105 211 Gene3D G3DSA:3.40.190.10 -
1 23 Phobius SIGNAL_PEPTIDE Signal peptide region
20 23 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
8 19 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
31 248 NCBIfam TIGR01256 molybdate ABC transporter substrate-binding protein
31 248 InterPro IPR005950 Molybdate ABC transporter, substrate-binding protein

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

4 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 7T4Z
X-ray 1.78 Å A,B
92.0% 21-251
Viewing
PDB 7T50
X-ray 1.90 Å A,B
92.0% 21-251
Loaded
PDB 7T5A
X-ray 2.16 Å A,B
92.0% 21-251
Loaded
PDB 7T51
X-ray 2.50 Å A,B
92.0% 21-251
Loaded
AlphaFold PA1863
AlphaFold full sequence Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.651
3 0.398

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 12.47 0.652
2 0.91 0.004

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

5 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
CQ4 P37329 116.0 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][Cr](=O)(=O)[O-]
MOO P37329 159.9 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][Mo](=O)(=O)[O-]
REO P37329 250.2 Da LogP -1.55 TPSA 74.3 ✓ Ro5 ✓ Clean [O-][Re](=O)(=O)=O
SBT Q18A64 74.1 Da LogP 0.78 TPSA 20.2 ✓ Ro5 ✓ Clean CC[C@H](C)O
WO4 P37329 247.8 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][W](=O)(=O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.