Protein profile

PA1897

hypothetical protein

Genome: NC_002516.2

Gene: PA1897 Structure source: AlphaFold UniProt Q9I2K0
Amino acids 255
Annotations 4
Features 18
PDB binders 0
Druggability 0.752

Overview

Basic information about this protein and its source genome.

Accession
PA1897
Gene
PA1897
Status
annotated
Amino acids
255
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
26.812
Human E-value
5.83e-07
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.752
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MIYYLIGVALFIFMLEQLVPGWKLPKVSTWVARVIFLNIVQVSIALLAGITWNKWMMGHSLLHTSDALPPLLAGFAAYFVNTFVTYWWHRARHANDTLWRLFHQLHHAPQRIEVFTSFYKHPTEMVFNSLLGSFVAYVVMGISIEAGAYYIMFAALGEMFYHSNLRTPHVLGYLFQRPEMHRIHHQRDRHECNYSDFPIWDMLFGTYENPRRIDEPQGFAGDKEQQFVDMLLFRDVHSLPGKTQPAPVLVKPDVR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005506 Binding to an iron (Fe) ion.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0008610 The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
22 30 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
31 50 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
67 89 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
134 156 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
5 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
51 70 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
30 52 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
16 21 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 21 Phobius SIGNAL_PEPTIDE Signal peptide region
130 152 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
4 23 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
71 89 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
76 206 Pfam PF04116 Fatty acid hydroxylase
76 206 InterPro IPR006694 Fatty acid hydroxylase
90 133 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
157 255 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
24 211 PANTHER PTHR11863 STEROL DESATURASE

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1897
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.752