Protein profile

PA1900

phenazine biosynthesis protein PhzB

Genome: NC_002516.2

Gene: PA1900 phzB2 Structure source: Experimental + AlphaFold UniProt Q9S508
Amino acids 162
Annotations 2
Features 6
PDB binders 0
Druggability 0.752

Overview

Basic information about this protein and its source genome.

Accession
PA1900
Gene
PA1900 phzB2
Status
annotated
Amino acids
162
Structure source
Experimental + AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.752
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIPT

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0002047 The chemical reactions and pathways resulting in the formation of a phenazine antibiotic, a polycyclic pyrazine with two nitrogen atoms in the ring.
  • GO:0017000 The chemical reactions and pathways resulting in the formation of an antibiotic, a substance produced by or derived from certain fungi, bacteria, and other organisms, that can destroy or inhibit the growth of other microorganisms.

Sequence Features

Domain/signature hits from InterPro and related databases.

6 records
Show feature table
Start End DB Term Name
1 162 Pfam PF03284 Phenazine biosynthesis protein A/B
1 162 InterPro IPR004964 Phenazine biosynthesis protein A/B
12 152 Gene3D G3DSA:3.10.450.50 -
19 148 SUPERFAMILY SSF54427 NTF2-like
19 148 InterPro IPR032710 NTF2-like domain superfamily
12 152 FunFam G3DSA:3.10.450.50:FF:000014 Phenazine biosynthesis protein PhzB 2

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

1 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 3FF0
X-ray 1.90 Å A,B
100.0% 1-162
Viewing
AlphaFold PA1900
AlphaFold full sequence Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.752

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 42.16 0.967