Protein profile

PA1954

hypothetical protein

Genome: NC_002516.2

Gene: fapC PA1954 Structure source: AlphaFold UniProt Q9I2F0
Amino acids 340
Annotations 4
Features 7
PDB binders 0
Druggability 0.689

Overview

Basic information about this protein and its source genome.

Accession
PA1954
Gene
fapC PA1954
Status
annotated
Amino acids
340
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.689
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKATMVLTPLALAMAAVLSVSAYAGNEGGWHPPKPNPQSNNKGGATALVVDTQQNYNNKVSNFGTLNNASVSGSIKDASGNVGVNVAAGDNNQQANAAALASADASFVFGTATASTSVLQSGYGNTLNNYSNPNTASLSNSANNVSGNLGVNVAAGNFNQQKNDLAAAVSNGQYSTAGSAASQTSTGNTTVNSANYAYGGTYVSLKLNADGSYKGTSDQIGDVYLDTWEGQTHPGGSNTGHIDVDSQAQGAKDLNHDGGAFAFKEKGDVDLKGTVSGFIPAIVGFKTPVTNNASLSNSLQNVSGNVGVNIAAGGGNQQSNSLSIAAGCSSCPAGGESLGF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005576 The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
  • GO:0009289 A proteinaceous hair-like appendage on the surface of bacteria ranging from 2-8 nm in diameter.
  • GO:1990000 The generation of amyloid fibrils, insoluble fibrous protein aggregates exhibiting beta sheet structure, from proteins.
  • GO:0007155 The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.

Sequence Features

Domain/signature hits from InterPro and related databases.

7 records
Show feature table
Start End DB Term Name
25 340 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 24 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
19 24 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
6 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 24 Phobius SIGNAL_PEPTIDE Signal peptide region
1 24 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1954
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
4 0.689
1 0.667