Protein profile

PA1957

hypothetical protein

Genome: NC_002516.2

Gene: PA1957 Structure source: AlphaFold UniProt Q9I2E7

Export view

Amino acids 175

Annotations 1

Features 8

PDB binders 0

Druggability 0.674

Overview

Basic information about this protein and its source genome.

Accession: PA1957
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1957
Status: annotated
Amino acids: 175
Structure source: AlphaFold

GO:0000309 Catalysis of the reaction: beta-nicotinamide D-ribonucleotide + ATP + H+ = diphosphate + NAD+.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.674

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MKVLVLTGPESSGKSWLAEQLQARFGGRVVGEYVRHFIDEQRRDTCYADIPAIARGQLAWEDAARAERPALLILDTHLLSNILWSRILFGDCPDWLEPALLRRRYDLHLLLSPEGVAWSADGQRCQPELAQRQAFHRECQAWLERHRQPYRAIAGDWAERRRQAFAAVQGLLQDG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0000309 Catalysis of the reaction: beta-nicotinamide D-ribonucleotide + ATP + H+ = diphosphate + NAD+.

Sequence Features

Domain/signature hits from InterPro and related databases.

8 records

Show feature table

Start	End	DB	Term	Name
2	169	SUPERFAMILY	SSF52540	P-loop containing nucleoside triphosphate hydrolases
2	169	InterPro	IPR027417	P-loop containing nucleoside triphosphate hydrolase
2	164	Gene3D	G3DSA:3.40.50.300	-
2	164	InterPro	IPR027417	P-loop containing nucleoside triphosphate hydrolase
2	164	FunFam	G3DSA:3.40.50.300:FF:003039	Nicotinamide-nucleotide adenylyltransferase
2	174	PANTHER	PTHR37512	TRIFUNCTIONAL NAD BIOSYNTHESIS/REGULATOR PROTEIN NADR
5	160	Pfam	PF13521	AAA domain
5	160	InterPro	IPR038727	NadR/Ttd14, AAA domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1957	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.674