Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA2019
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: amrA PA2019
Status: annotated
Amino acids: 396
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other. GO:0046677 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it. GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.669

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MHIQWTGSLRGLLAALVALFLLGCEEAADAGKTAEAPAEVGVIVARPAPIGITSELPGRLEAYRQAEVRARVAGIVTRRLYEEGQDVRAGTVLFQIDPAPLKAALDISRGALARAEASHAAAADKLKRYADLIKDRAISEREYTEAQTDARQALAQIASAKAELEQARLRLGYATVTAPIDGRARRALVTEGALVGEDSPTPLTRVEQIDPIYVNFSQPAGEVAAMQRAIREGQVKGVADKDIAVRLVLADGSEYPLAGELLFSDLAVDPGTDTIAMRALFRNPHRELLPGGYVQVRLQRAVNPQAITVPRDALIRTAQSAVVKVVNPKGLVEDVEVRADTLQGRDWIISRGLKGGEWVIVENAAQHAAGSSVQAVVRQPASADAPSPLAASPAGQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
GO:0046677 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Sequence Features

Domain/signature hits from InterPro and related databases.

22 records

Show feature table

Start	End	DB	Term	Name
1	30	SignalP_EUK	SignalP-noTM	SignalP-noTM
1	27	Phobius	SIGNAL_PEPTIDE	Signal peptide region
1	27	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
99	172	Gene3D	G3DSA:1.10.287.470	Helix hairpin bin
1	10	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
64	208	Gene3D	G3DSA:2.40.50.100	-
28	396	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
286	376	Gene3D	G3DSA:2.40.420.20	-
53	300	SUPERFAMILY	SSF111369	HlyD-like secretion proteins
58	285	Gene3D	G3DSA:2.40.30.170	-
286	376	FunFam	G3DSA:2.40.420.20:FF:000040	Multidrug efflux RND transporter periplasmic adaptor subunit MexX
11	22	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
143	170	Coils	Coil	Coil
2	387	PANTHER	PTHR30158	ACRA/E-RELATED COMPONENT OF DRUG EFFLUX TRANSPORTER
62	294	Pfam	PF16576	Barrel-sandwich domain of CusB or HlyD membrane-fusion
62	294	InterPro	IPR032317	RND efflux pump, membrane fusion protein, barrel-sandwich domain
1	27	SignalP_GRAM_NEGATIVE	SignalP-noTM	SignalP-noTM
40	360	Pfam	PF00529	Cation efflux system protein CusB domain 1
40	360	InterPro	IPR043602	Cation efflux system protein CusB, domain 1
23	27	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
42	375	NCBIfam	TIGR01730	efflux RND transporter periplasmic adaptor subunit
42	375	InterPro	IPR006143	RND efflux pump, membrane fusion protein

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2019	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.669
5				0.601
6				0.386
10				0.204

PA2019