Protein profile
PA2019
multidrug efflux lipoprotein
Genome: NC_002516.2
Overview
Basic information about this protein and its source genome.
- Accession
- PA2019
- Gene
- amrA PA2019
- Status
- annotated
- Amino acids
- 396
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MHIQWTGSLRGLLAALVALFLLGCEEAADAGKTAEAPAEVGVIVARPAPIGITSELPGRLEAYRQAEVRARVAGIVTRRLYEEGQDVRAGTVLFQIDPAPLKAALDISRGALARAEASHAAAADKLKRYADLIKDRAISEREYTEAQTDARQALAQIASAKAELEQARLRLGYATVTAPIDGRARRALVTEGALVGEDSPTPLTRVEQIDPIYVNFSQPAGEVAAMQRAIREGQVKGVADKDIAVRLVLADGSEYPLAGELLFSDLAVDPGTDTIAMRALFRNPHRELLPGGYVQVRLQRAVNPQAITVPRDALIRTAQSAVVKVVNPKGLVEDVEVRADTLQGRDWIISRGLKGGEWVIVENAAQHAAGSSVQAVVRQPASADAPSPLAASPAGQ
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
5- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0046677 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 30 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 1 | 27 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 1 | 27 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 99 | 172 | Gene3D | G3DSA:1.10.287.470 | Helix hairpin bin |
| 1 | 10 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 64 | 208 | Gene3D | G3DSA:2.40.50.100 | - |
| 28 | 396 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 286 | 376 | Gene3D | G3DSA:2.40.420.20 | - |
| 53 | 300 | SUPERFAMILY | SSF111369 | HlyD-like secretion proteins |
| 58 | 285 | Gene3D | G3DSA:2.40.30.170 | - |
| 286 | 376 | FunFam | G3DSA:2.40.420.20:FF:000040 | Multidrug efflux RND transporter periplasmic adaptor subunit MexX |
| 11 | 22 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 143 | 170 | Coils | Coil | Coil |
| 2 | 387 | PANTHER | PTHR30158 | ACRA/E-RELATED COMPONENT OF DRUG EFFLUX TRANSPORTER |
| 62 | 294 | Pfam | PF16576 | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 62 | 294 | InterPro | IPR032317 | RND efflux pump, membrane fusion protein, barrel-sandwich domain |
| 1 | 27 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 40 | 360 | Pfam | PF00529 | Cation efflux system protein CusB domain 1 |
| 40 | 360 | InterPro | IPR043602 | Cation efflux system protein CusB, domain 1 |
| 23 | 27 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 42 | 375 | NCBIfam | TIGR01730 | efflux RND transporter periplasmic adaptor subunit |
| 42 | 375 | InterPro | IPR006143 | RND efflux pump, membrane fusion protein |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2019
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.669 | ||||||
| 5 | 0.601 | ||||||
| 6 | 0.386 | ||||||
| 10 | 0.204 |