Protein profile

PA2074

hypothetical protein

Genome: NC_002516.2

Gene: PA2074 Structure source: AlphaFold UniProt Q9I241
Amino acids 270
Annotations 3
Features 14
PDB binders 8
Druggability 0.706

Overview

Basic information about this protein and its source genome.

Accession
PA2074
Gene
PA2074
Status
annotated
Amino acids
270
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
32.27
Human E-value
1.4500000000000002e-21
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.706
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MAKVTVACCQIAPRIGAQEHNLRLAERAIREAARRGANVVVLPELAASGYVFADRGEALALAETRDGPSLGLWKALAGELDLVIVGGFCERLDPQRVANSAALVDADGVRAIYRKAHLWNEESGIFEAGEQPPPVVATRFGRIAVMVCYDLEFPEWVRLPALSGAQLLCAPVNWPAAPRPEGERPAEVVRVQANASVNRLFIAACDRCGQERGVDWVGGSVIVDADGYPLDGPLQGEAGMLLARLDLAEADEKRISAHNHVHRDRRPELY

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0050126 Catalysis of the reaction: N-carbamoylputrescine + H2O + 2 H+ = CO2 + NH4 + putrescine.
  • GO:0033388 The chemical reactions and pathways resulting in the formation of putrescine, 1,4-diaminobutane, from other compounds, including arginine.
  • GO:0006807 OBSOLETE. The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.

Sequence Features

Domain/signature hits from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
1 270 SUPERFAMILY SSF56317 Carbon-nitrogen hydrolase
1 270 InterPro IPR036526 Carbon-nitrogen hydrolase superfamily
3 270 FunFam G3DSA:3.60.110.10:FF:000044 Carbon-nitrogen hydrolase
5 252 Pfam PF00795 Carbon-nitrogen hydrolase
5 252 InterPro IPR003010 Carbon-nitrogen hydrolase
3 270 PANTHER PTHR43674 NITRILASE C965.09-RELATED
3 270 Gene3D G3DSA:3.60.110.10 -
3 270 InterPro IPR036526 Carbon-nitrogen hydrolase superfamily
4 247 ProSiteProfiles PS50263 Carbon-nitrogen hydrolase domain profile.
4 247 InterPro IPR003010 Carbon-nitrogen hydrolase
15 35 Coils Coil Coil
5 270 CDD cd07580 nitrilase_2
144 164 ProSitePatterns PS01227 Uncharacterized protein family UPF0012 signature.
144 164 InterPro IPR001110 Uncharacterised protein family UPF0012, conserved site

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2074
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.706
2 0.367

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
CDT P60327 192.2 Da LogP -0.14 TPSA 92.4 ✓ Ro5 ✓ Clean CSCC[C@H](C(=O)O)NC(=O)N
CDV P60327 160.2 Da LogP -0.24 TPSA 92.4 ✓ Ro5 ✓ Clean CC(C)[C@H](C(=O)O)NC(=O)N
EMC O76463 229.7 Da LogP 0.97 TPSA 0.0 ✓ Ro5 ✓ Clean CC[Hg+]
ING P60327 208.2 Da LogP 0.35 TPSA 92.4 ✓ Ro5 ✓ Clean c1ccc(cc1)C[C@@H](C(=O)O)NC(=O)N
N2H G7ITU5 134.2 Da LogP -1.42 TPSA 78.5 ✓ Ro5 ✓ Clean C(CCNC(O)O)CN
N2P G7ITU5 102.2 Da LogP 0.07 TPSA 52.0 ✓ Ro5 ✓ Clean C(CCN)CCN
P6W O58376 130.1 Da LogP -0.87 TPSA 86.2 ✓ Ro5 ✓ Clean C(CC(=O)N)CC(=O)N
PUT G7ITU5 88.2 Da LogP -0.32 TPSA 52.0 ✓ Ro5 ✓ Clean C(CCN)CN

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.