Overview
Basic information about this protein and its source genome.
- Accession
- PA2216
- Gene
- PA2216
- Status
- annotated
- Amino acids
- 331
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRLIQFEDRAGQRRVGVVEGAGIQVLRGVRSTRELGLAAIRAGSGLHDEVLRRGSEPGPDYAGLLEEGRVLPPLDHDDPAHCLVSGTGLTHLGSAATRDRMHQQNQGDETALTDTMRIFRWGLEGGKPPAGQVGAQPEWFYKGDGGIVVRPGADFPLPAFAEDAGEEPELVGLYLIGDDRRPYRLGYALGNEFSDHLMERRNYLYLAHSKLRACCYGPELRVGELPRHLQGESRILRDGEVLWQQAFLSGEDNMCHSLENLEYHHFKYAQFLRPGDVHVHYFGTATLSFADGIKAAPGDVFEIAMAEFGAPLRNGIAAVETALTPGRVVAL
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 112 | 316 | SUPERFAMILY | SSF56529 | FAH |
| 112 | 316 | InterPro | IPR036663 | Fumarylacetoacetase-like, C-terminal domain superfamily |
| 1 | 331 | PIRSF | PIRSF033905 | UCP033905 |
| 1 | 331 | InterPro | IPR009645 | Uncharacterised conserved protein GguC |
| 85 | 320 | Gene3D | G3DSA:3.90.850.10 | - |
| 85 | 320 | InterPro | IPR036663 | Fumarylacetoacetase-like, C-terminal domain superfamily |
| 1 | 321 | NCBIfam | NF040903 | GguC family protein |
| 1 | 321 | InterPro | IPR009645 | Uncharacterised conserved protein GguC |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2216
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.681 | ||||||
| 5 | 0.506 |