Protein profile

PA2266

cytochrome C

Genome: NC_002516.2

Gene: PA2266 Structure source: AlphaFold UniProt Q9I1K7
Export view
Amino acids 439
Annotations 6
Features 40
PDB binders 0
Druggability 0.691

Overview

Basic information about this protein and its source genome.

Accession
PA2266
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA2266
Status
annotated
Amino acids
439
Structure source
AlphaFold
GO
GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways. GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring. GO:0005506 Binding to an iron (Fe) ion. GO:0016614 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.691
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MKPTAFLALSALACGIAQAAAAPDPALVRQGEYLARAGDCVACHTARDGKPFAGGLPMETPIGAVYSTNITPDRKTGIGDYSFEDFDRAVRHGVARSGDTLYPAMPYPSYARVSEADMRALYAYFMHGVEPVEQPNKASDIPWPLSMRWPLAFWRWTFAPEVKDFQAAAGQDPVLARGAYLVEGLGHCGACHTPRGLGMQEKALAASDGAAYLSGSAPLENWIAKSLRGDHRTGLGSWSEADLVSFLRTGRSERSAVFGGMSDVVVHSMQYMTDADLTAIARYLKSLPPADPADQPHVYDESVAQALFHGDDSKTGAALYVDNCGACHRTDGKGYARVFPALAGNPVVTGSDPTSLVHIVLKGGTLPATHQAPSSFTMPPFGWRMNDQEIADVVNFIRTSWGNQAPSVSVDEVRRLRKDTGAAAVGDIPPPGSAAADRG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
  • GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
  • GO:0005506 Binding to an iron (Fe) ion.
  • GO:0016614 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

40 records
Show feature table
Start End DB Term Name
311 401 ProSiteProfiles PS51007 Cytochrome c family profile.
311 401 InterPro IPR009056 Cytochrome c-like domain
5 16 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 19 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
1 21 SignalP_EUK SignalP-noTM SignalP-noTM
6 420 PANTHER PTHR35008 BLL4482 PROTEIN-RELATED
322 333 PRINTS PR00605 Class IC cytochrome C signature
322 333 InterPro IPR008168 Cytochrome c, class IC
375 397 PRINTS PR00605 Class IC cytochrome C signature
375 397 InterPro IPR008168 Cytochrome c, class IC
315 417 SUPERFAMILY SSF46626 Cytochrome c
315 417 InterPro IPR036909 Cytochrome c-like domain superfamily
293 426 Gene3D G3DSA:1.10.760.10 -
293 426 InterPro IPR036909 Cytochrome c-like domain superfamily
157 292 Gene3D G3DSA:1.10.760.10 -
157 292 InterPro IPR036909 Cytochrome c-like domain superfamily
1 21 Phobius SIGNAL_PEPTIDE Signal peptide region
2 134 Gene3D G3DSA:1.10.760.10 -
2 134 InterPro IPR036909 Cytochrome c-like domain superfamily
2 435 PIRSF PIRSF000018 Mb_ADH_cytochrome_c
2 435 InterPro IPR014353 Membrane-bound alcohol dehydrogenase, cytochrome c subunit
19 152 SUPERFAMILY SSF46626 Cytochrome c
19 152 InterPro IPR036909 Cytochrome c-like domain superfamily
173 288 ProSiteProfiles PS51007 Cytochrome c family profile.
173 288 InterPro IPR009056 Cytochrome c-like domain
176 293 SUPERFAMILY SSF46626 Cytochrome c
176 293 InterPro IPR036909 Cytochrome c-like domain superfamily
313 397 Pfam PF13442 Cytochrome C oxidase, cbb3-type, subunit III
313 397 InterPro IPR009056 Cytochrome c-like domain
419 439 MobiDBLite mobidb-lite consensus disorder prediction
1 19 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
17 21 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
30 127 Pfam PF00034 Cytochrome c
30 127 InterPro IPR009056 Cytochrome c-like domain
176 287 Pfam PF00034 Cytochrome c
176 287 InterPro IPR009056 Cytochrome c-like domain
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
26 129 ProSiteProfiles PS51007 Cytochrome c family profile.
26 129 InterPro IPR009056 Cytochrome c-like domain
22 439 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2266
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.691
2 0.284