Overview
Basic information about this protein and its source genome.
- Accession
- PA2267
- Gene
- PA2267
- Status
- annotated
- Amino acids
- 298
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MQKMNAPLQYRLDHADLALVLALVRGGSLARAAELLRVDVSTVFRAIRRLEKNLGKALFDKSRSGYLANQTARRLAQQAELAEQALEAARIGLELEREVLSGTVRMTCSDAVLHGLLLPALARFMPGYPALQLELATSNDFANLSRRDADIALRMTRTPPEHLVGRNLGEVRYVLCASERYLEGRDATEPAMLHWIAPDDFLPDHPSVVWRRRHYPGVLPAYRCNGVLAVAEMARAGLGLAAIPAYLLRDGDGLRVLDADLEGCASALWLLTRPDCRALRSVVVLFDELGRHVRLGDE
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 32 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 25 | 32 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 16 | 65 | Pfam | PF00126 | Bacterial regulatory helix-turn-helix protein, lysR family |
| 16 | 65 | InterPro | IPR000847 | Transcription regulator HTH, LysR |
| 100 | 293 | SUPERFAMILY | SSF53850 | Periplasmic binding protein-like II |
| 69 | 89 | Coils | Coil | Coil |
| 99 | 292 | Pfam | PF03466 | LysR substrate binding domain |
| 99 | 292 | InterPro | IPR005119 | LysR, substrate-binding |
| 33 | 298 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 6 | 91 | Gene3D | G3DSA:1.10.10.10 | - |
| 6 | 91 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 17 | 24 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 10 | 295 | PANTHER | PTHR30579 | TRANSCRIPTIONAL REGULATOR |
| 10 | 122 | SUPERFAMILY | SSF46785 | Winged helix DNA-binding domain |
| 10 | 122 | InterPro | IPR036390 | Winged helix DNA-binding domain superfamily |
| 1 | 16 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 97 | 291 | Gene3D | G3DSA:3.40.190.290 | - |
| 12 | 69 | ProSiteProfiles | PS50931 | LysR-type HTH domain profile. |
| 12 | 69 | InterPro | IPR000847 | Transcription regulator HTH, LysR |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2267
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.674 | ||||||
| 5 | 0.205 |