Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA2267
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA2267
Status: annotated
Amino acids: 298
Structure source: AlphaFold

GO

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.674

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MQKMNAPLQYRLDHADLALVLALVRGGSLARAAELLRVDVSTVFRAIRRLEKNLGKALFDKSRSGYLANQTARRLAQQAELAEQALEAARIGLELEREVLSGTVRMTCSDAVLHGLLLPALARFMPGYPALQLELATSNDFANLSRRDADIALRMTRTPPEHLVGRNLGEVRYVLCASERYLEGRDATEPAMLHWIAPDDFLPDHPSVVWRRRHYPGVLPAYRCNGVLAVAEMARAGLGLAAIPAYLLRDGDGLRVLDADLEGCASALWLLTRPDCRALRSVVVLFDELGRHVRLGDE

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records

Show feature table

Start	End	DB	Term	Name
1	32	Phobius	SIGNAL_PEPTIDE	Signal peptide region
25	32	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
16	65	Pfam	PF00126	Bacterial regulatory helix-turn-helix protein, lysR family
16	65	InterPro	IPR000847	Transcription regulator HTH, LysR
100	293	SUPERFAMILY	SSF53850	Periplasmic binding protein-like II
69	89	Coils	Coil	Coil
99	292	Pfam	PF03466	LysR substrate binding domain
99	292	InterPro	IPR005119	LysR, substrate-binding
33	298	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
6	91	Gene3D	G3DSA:1.10.10.10	-
6	91	InterPro	IPR036388	Winged helix-like DNA-binding domain superfamily
17	24	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
10	295	PANTHER	PTHR30579	TRANSCRIPTIONAL REGULATOR
10	122	SUPERFAMILY	SSF46785	Winged helix DNA-binding domain
10	122	InterPro	IPR036390	Winged helix DNA-binding domain superfamily
1	16	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
97	291	Gene3D	G3DSA:3.40.190.290	-
12	69	ProSiteProfiles	PS50931	LysR-type HTH domain profile.
12	69	InterPro	IPR000847	Transcription regulator HTH, LysR

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2267	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.674
5				0.205

PA2267