Protein profile

PA2275

alcohol dehydrogenase

Genome: NC_002516.2

Gene: PA2275 Structure source: AlphaFold UniProt Q9I1J9
Amino acids 353
Annotations 4
Features 19
PDB binders 6
Druggability 0.745

Overview

Basic information about this protein and its source genome.

Accession
PA2275
Gene
PA2275
Status
annotated
Amino acids
353
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
31.579
Human E-value
2.52e-06
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.745
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTLQIRGYAAQSASTPLTAHRFERRAPRADDLVIDILYCGVCHSDLHQARNEWHNSLYPLVPGHEIIGRVASVGEAVSGFAVGELVGVGCMVDSCRHCAACSEGLEQYCAEYPTLTYNGRDRHDGLPTFGGYSERIVVSARFVLRIPQGLDPKAAAPLLCAGITSYSPLRHWKVGPGSRVAVVGLGGLGHMGLKFARALGAEVALFTRSPGKEEEARRLGADQVILSTDPQRMAAVAGRFDLILDTVPHQHDLNPYLATLKRDGTLVLVGLLEPLEPAVHGAQLVMGRRSIAGSAIGGIAETQEMLDFCAAHGIACDIEMIEIQQINQAYERMLASDVKYRFVIDMASLQKSF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0008106 Catalysis of the reaction: an alcohol + NADP+ = an aldehyde or ketone + NADPH + H+.
  • GO:0016616 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
63 77 ProSitePatterns PS00059 Zinc-containing alcohol dehydrogenases signature.
63 77 InterPro IPR002328 Alcohol dehydrogenase, zinc-type, conserved site
5 347 PANTHER PTHR42683 ALDEHYDE REDUCTASE
5 347 InterPro IPR047109 Cinnamyl alcohol dehydrogenase-like
13 173 SUPERFAMILY SSF50129 GroES-like
13 173 InterPro IPR011032 GroES-like superfamily
14 344 SMART SM00829 PKS_ER_names_mod
14 344 InterPro IPR020843 Polyketide synthase, enoylreductase domain
30 145 Pfam PF08240 Alcohol dehydrogenase GroES-like domain
30 145 InterPro IPR013154 Alcohol dehydrogenase-like, N-terminal
6 345 CDD cd05283 CAD1
6 345 InterPro IPR047109 Cinnamyl alcohol dehydrogenase-like
187 310 Pfam PF00107 Zinc-binding dehydrogenase
187 310 InterPro IPR013149 Alcohol dehydrogenase-like, C-terminal
161 316 FunFam G3DSA:3.40.50.720:FF:000022 Cinnamyl alcohol dehydrogenase
150 314 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
150 314 InterPro IPR036291 NAD(P)-binding domain superfamily
8 346 Gene3D G3DSA:3.90.180.10 -
161 316 Gene3D G3DSA:3.40.50.720 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2275
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.745

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BMD P42328 87.1 Da LogP 0.27 TPSA 43.1 ✓ Ro5 ✓ Clean CCCC(=O)N
DTT M4VRJ6 154.3 Da LogP -0.43 TPSA 40.5 ✓ Ro5 ✓ Clean C([C@@H]([C@H](CS)O)O)S
ETF P42328 100.0 Da LogP 0.54 TPSA 20.2 ✓ Ro5 ✓ Clean C(C(F)(F)F)O
FU2 Q46UZ9 96.1 Da LogP 1.09 TPSA 30.2 ✓ Ro5 ✓ Clean c1cc(oc1)C=O
ISP Q46UZ9 140.1 Da LogP 0.50 TPSA 66.8 ✓ Ro5 ✓ Clean CC(C)OP(=O)(O)O
MLT C5XC49 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.