Overview
Basic information about this protein and its source genome.
- Accession
- PA2297
- Gene
- PA2297
- Status
- annotated
- Amino acids
- 81
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAYRPQDIFFRSSAPVTIDEDRCIADKGCTVCVEVCPMDLLAIDPTTRKAYMAYDECWYCMPCEKDCPTGAVKVEIPYLLR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
- GO:0046872 Binding to a metal ion.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 28 | 71 | Pfam | PF13187 | 4Fe-4S dicluster domain |
| 28 | 71 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 14 | 46 | ProSiteProfiles | PS51379 | 4Fe-4S ferredoxin-type iron-sulfur binding domain profile. |
| 14 | 46 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 16 | 75 | PANTHER | PTHR43122 | FERREDOXIN SUBUNIT OF PYRUVATE:FLAVODOXIN OXIDOREDUCTASE-RELATED |
| 48 | 77 | ProSiteProfiles | PS51379 | 4Fe-4S ferredoxin-type iron-sulfur binding domain profile. |
| 48 | 77 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 57 | 68 | ProSitePatterns | PS00198 | 4Fe-4S ferredoxin-type iron-sulfur binding region signature. |
| 57 | 68 | InterPro | IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
| 15 | 76 | Gene3D | G3DSA:3.30.70.20 | - |
| 9 | 74 | SUPERFAMILY | SSF54862 | 4Fe-4S ferredoxins |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2297
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.753 |