Protein profile

PA2312

transcriptional regulator

Genome: NC_002516.2

Gene: PA2312 Structure source: AlphaFold UniProt Q9I1G3
Export view
Amino acids 193
Annotations 3
Features 20
PDB binders 1
Druggability 0.729

Overview

Basic information about this protein and its source genome.

Accession
PA2312
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA2312
Status
annotated
Amino acids
193
Structure source
AlphaFold
GO
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.729
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MHTEPDDLIGQRVAHNLLRLRGKRNLSLDALARISGVSRAMLAQIESGRSVPSIKVLCKIAQGLKVSVAAFLDDRAFAGVAVLPAQQSKRLVSADGAFTSRALFPFDVARQVEFYELRLRGLGQEDAEAHAPGTQENLVVAQGVLEVRVNEERFLLATGDSILFYADQPHSYRNPADSEALAYLVMTYPERLD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
5 77 Gene3D G3DSA:1.10.260.40 -
5 77 InterPro IPR010982 Lambda repressor-like, DNA-binding domain superfamily
12 189 PANTHER PTHR46797 HTH-TYPE TRANSCRIPTIONAL REGULATOR
16 71 SMART SM00530 mbf_short4
16 71 InterPro IPR001387 Cro/C1-type helix-turn-helix domain
126 184 Pfam PF07883 Cupin domain
126 184 InterPro IPR013096 Cupin 2, conserved barrel
56 190 SUPERFAMILY SSF51182 RmlC-like cupins
56 190 InterPro IPR011051 RmlC-like cupin domain superfamily
98 187 CDD cd02209 cupin_XRE_C
17 71 ProSiteProfiles PS50943 Cro/C1-type HTH domain profile.
17 71 InterPro IPR001387 Cro/C1-type helix-turn-helix domain
12 74 SUPERFAMILY SSF47413 lambda repressor-like DNA-binding domains
12 74 InterPro IPR010982 Lambda repressor-like, DNA-binding domain superfamily
99 192 Gene3D G3DSA:2.60.120.10 Jelly Rolls
99 192 InterPro IPR014710 RmlC-like jelly roll fold
19 69 Pfam PF01381 Helix-turn-helix
19 69 InterPro IPR001387 Cro/C1-type helix-turn-helix domain
14 71 CDD cd00093 HTH_XRE
14 71 InterPro IPR001387 Cro/C1-type helix-turn-helix domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2312
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.729
2 0.243

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 51 via homologs
Structural ligands 1 0 loaded crystals
Bioactive compounds 0 50 ZINC candidates
Drug-like & clean 51 0 PAINS alerts
Best available ligand signal
MED PDB via homolog 149.2 Da · LogP 0.15 · TPSA 63.3
MED PDB via homolog ZINC1674993 ZINC candidate · Tanimoto 0.640 ZINC1674994 ZINC candidate · Tanimoto 0.640 ZINC1674996 ZINC candidate · Tanimoto 0.640

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
MED
1Y9Q
Q9KQN0 149.2 Da LogP 0.15 TPSA 63.3 ✓ Ro5 ✓ Clean CSCC[C@H](C(=O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.