Overview
Basic information about this protein and its source genome.
- Accession
- PA2357
- Gene
- msuE slfA PA2357
- Status
- annotated
- Amino acids
- 186
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTSPFKVVAVSGGTYRPSRTLVLTQALIAELGQSLPIDSRVIELTDIAAPLGATLARNQAPAELQAVLDEIESADLLLVASPVYRGSYPGLLKHLFDLIDLNALIDTPVLLAATGGTERHALVLDHQLRPLFSFFQAITLPIGVYASEADFDNYRIVSEPLKARIRLAAERAAPLFGGRSELLKIA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
3- GO:0052873 Catalysis of the reaction: FMNH2 + NADP+ = FMN + NADPH + 2 H+.
- GO:0016655 Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a quinone or a similar acceptor molecule.
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 6 | 150 | Pfam | PF03358 | NADPH-dependent FMN reductase |
| 6 | 150 | InterPro | IPR005025 | NADPH-dependent FMN reductase-like |
| 5 | 182 | PANTHER | PTHR43408 | FMN REDUCTASE (NADPH) |
| 1 | 176 | SUPERFAMILY | SSF52218 | Flavoproteins |
| 1 | 176 | InterPro | IPR029039 | Flavoprotein-like superfamily |
| 6 | 177 | NCBIfam | TIGR03566 | FMN reductase |
| 6 | 177 | InterPro | IPR019912 | FMN reductase, MsuE-like |
| 1 | 176 | Gene3D | G3DSA:3.40.50.360 | - |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2357
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 4 | 0.687 | ||||||
| 1 | 0.443 | ||||||
| 2 | 0.392 |