Overview
Basic information about this protein and its source genome.
- Accession
- PA2415
- Gene
- PA2415
- Status
- annotated
- Amino acids
- 141
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MATALRFRPLDAFYNVLNPVPFGFFVAALVFDATYFATAEVMWGKSAAWLISLGLLFAILPCIVDLCRVWLLRRAAVVAAARVSSLLKFAGIVLAIFNAFVHSRDAYAVMPAGLWLSIATVLLLALGEALLAVSAEEVAHG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
No GO or EC annotations are currently loaded for this protein.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 102 | 112 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 38 | 48 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 141 | PIRSF | PIRSF029509 | UCP029509 |
| 1 | 141 | InterPro | IPR016923 | Uncharacterised conserved protein UCP029509, membrane |
| 72 | 82 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 50 | 72 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 12 | 37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 134 | 141 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 13 | 35 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 83 | 101 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 111 | 133 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 79 | 101 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 113 | 133 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 49 | 71 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2415
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.667 | ||||||
| 3 | 0.561 |