Protein profile

PA2415

hypothetical protein

Genome: NC_002516.2

Gene: PA2415 Structure source: AlphaFold UniProt Q9I166
Amino acids 141
Annotations 0
Features 15
PDB binders 0
Druggability 0.667

Overview

Basic information about this protein and its source genome.

Accession
PA2415
Gene
PA2415
Status
annotated
Amino acids
141
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.667
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MATALRFRPLDAFYNVLNPVPFGFFVAALVFDATYFATAEVMWGKSAAWLISLGLLFAILPCIVDLCRVWLLRRAAVVAAARVSSLLKFAGIVLAIFNAFVHSRDAYAVMPAGLWLSIATVLLLALGEALLAVSAEEVAHG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
102 112 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
38 48 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 141 PIRSF PIRSF029509 UCP029509
1 141 InterPro IPR016923 Uncharacterised conserved protein UCP029509, membrane
72 82 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
50 72 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
12 37 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
134 141 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
13 35 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
83 101 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
111 133 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
79 101 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
113 133 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
49 71 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2415
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.667
3 0.561