Protein profile

PA2540

hypothetical protein

Genome: NC_002516.2

Gene: PA2540 Structure source: AlphaFold UniProt Q9I0U4
Amino acids 586
Annotations 2
Features 15
PDB binders 7
Druggability 0.746

Overview

Basic information about this protein and its source genome.

Accession
PA2540
Gene
PA2540
Status
annotated
Amino acids
586
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
30.088
Human E-value
2.46e-10
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.746
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MRDVQELRFTTHDGVELFYRHWPASRPAPDGTRQAVLLFHRGHEHSGRIAHLVDELDLPEHDFFAWDARGHGLSPGARGDSPSFATSVRDVQTFVDHIQAVHGIAEERMAVVAQSVGAVLVSTWAHDYAPKVRALVLASPAFQVKLYVPFARSGLKLMRLWRGNFFVNSYVKARFLSHDPERIASYDSDPLIAKAISVNVLLGLYEAAERVVADAQAIQIPTQLLISGADFVVHRAPQERFFERLGSLRKEKHILPGFFHDTLGERDRHLAVGRARRFLLEAFATAPERPSLLDADRLGHTCAEAEALAAPLPKNSPRDLYWRATRAGLRLGSLWSDGVKLGFDTGFDSGSTLDYVYRNQPCGSGPLGRLIDRNYLDSIGWRGIRQRKLHVEELLRLAMQRLREEQREVRIVDIAAGHGRYILEALQGVEPLPESILLRDYSEINVRDGSALIESKGLAGIARFVKGDAFDRADLAALQPKPSLGVVSGLYELFADNRMVGDSLAGLGEALEEGGYLVYTGQPWHPQLELIARALTSHRQGQAWVMRRRTQAEMDQLVAAAGFRKITQRVDQWGIFSVSLAQKVAR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0016298 Catalysis of the hydrolysis of a lipid.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
2 286 Gene3D G3DSA:3.40.50.1820 alpha/beta hydrolase
2 286 InterPro IPR029058 Alpha/Beta hydrolase fold
344 585 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
344 585 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
276 583 Pfam PF12147 Putative methyltransferase
276 583 InterPro IPR022744 Methyltransferase domain, putative
4 282 SUPERFAMILY SSF53474 alpha/beta-Hydrolases
4 282 InterPro IPR029058 Alpha/Beta hydrolase fold
2 284 FunFam G3DSA:3.40.50.1820:FF:000201 Alpha/beta fold hydrolase
32 267 Pfam PF12146 Serine aminopeptidase, S33
32 267 InterPro IPR022742 Serine aminopeptidase, S33
12 268 PANTHER PTHR11614 PHOSPHOLIPASE-RELATED
340 584 FunFam G3DSA:3.40.50.150:FF:000266 Alpha/beta fold hydrolase
400 575 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
400 575 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2540
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
3 0.746
2 0.68

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

157 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
9JX Q99685 467.0 Da LogP 4.03 TPSA 56.8 ✓ Ro5 ✓ Clean c1ccc(c(c1)c2cccc(c2)N3C[C@@H](CC3=O)N4CCN(CC4)…
E3A Q99685 384.4 Da LogP 1.86 TPSA 84.7 ✓ Ro5 ✓ Clean c1cc(ccc1n2ccc(n2)C3[C@H]4[C@@H]3CN(C4)C(=O)ON5…
F4P Q99685 383.4 Da LogP 2.93 TPSA 54.3 ✓ Ro5 ✓ Clean c1cc(ccc1C(c2ccc(cc2)F)N3CCN(CC3)C(=O)n4cncn4)F
LDA A0A6I8WFT7 229.4 Da LogP 4.48 TPSA 23.1 ✓ Ro5 ✓ Clean CCCCCCCCCCCC[N+](C)(C)[O-]
XOV Q99685 396.8 Da LogP 2.99 TPSA 67.9 ✓ Ro5 ✓ Clean c1cc(c(cc1F)Cl)OCC2CCN(CC2)C(=O)C3CC4(C3)COC(=O…
XP7 Q99685 382.9 Da LogP 3.16 TPSA 58.6 ✓ Ro5 ✓ Clean c1cc(c(cc1F)Cl)OCC2CCN(CC2)C(=O)CC[C@@H]3CCC(=O…
XPD Q99685 418.9 Da LogP 3.74 TPSA 67.9 ✓ Ro5 ✓ Clean c1cc2c(cc1C(=O)N3CCC(CC3)COc4ccc(cc4Cl)F)NC(=O)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.