Protein profile

PA2549

hypothetical protein

Genome: NC_002516.2

Gene: PA2549 Structure source: AlphaFold UniProt Q9I0T5
Amino acids 347
Annotations 3
Features 33
PDB binders 0
Druggability 0.727

Overview

Basic information about this protein and its source genome.

Accession
PA2549
Gene
PA2549
Status
annotated
Amino acids
347
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.727
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MAALHAFLTEPFLGTATWFWLAFLAIVIVLLVLDLGVLQRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLVEQSLSMDNVFVMAMIFSFFGIPRRYQHQVLFWGILGAIVLRAIMIGLGAALVKEFDWIMYVFGAFLLFSGVKMLFNKHEEEPDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDASGKLVRYATPLFFALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRALYFSLAAMIHRFVYLKYALALVLVFIGAKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSLLKTRTPKATVEDKAEPNAEHALDRTSGHPR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0071467 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pH stimulus. pH is a measure of the acidity or basicity of an aqueous solution.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

33 records
Show feature table
Start End DB Term Name
90 108 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
116 138 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
237 241 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
92 109 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 37 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
31 323 PANTHER PTHR30238 MEMBRANE BOUND PREDICTED REDOX MODULATOR
212 236 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
143 161 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
109 114 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
263 273 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
16 321 NCBIfam TIGR03718 TerC/Alx family metal homeostasis membrane protein
16 321 InterPro IPR022369 Integral membrane protein TerC, riboswitch-linked
50 72 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
82 290 Pfam PF03741 Integral membrane protein TerC family
82 290 InterPro IPR005496 Integral membrane protein TerC
115 137 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 17 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
39 49 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
274 293 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
242 264 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
162 211 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
138 142 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
242 262 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
269 291 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
71 89 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
143 162 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
319 347 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
296 318 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
205 227 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
299 318 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
50 70 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
18 38 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
294 298 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2549
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
5 0.727
1 0.69