Overview
Basic information about this protein and its source genome.
- Accession
- PA2549
- Gene
- PA2549
- Status
- annotated
- Amino acids
- 347
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAALHAFLTEPFLGTATWFWLAFLAIVIVLLVLDLGVLQRDHHEIGVRESLLLSAGYFACGLAFGGWVWYAFGPTSAVEYYTGFLVEQSLSMDNVFVMAMIFSFFGIPRRYQHQVLFWGILGAIVLRAIMIGLGAALVKEFDWIMYVFGAFLLFSGVKMLFNKHEEEPDLEHNPVLRFLRKHMRVTKELHEHHFFVRLPDASGKLVRYATPLFFALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRALYFSLAAMIHRFVYLKYALALVLVFIGAKIMLHGVIGKIPAGLSLGVTFGLLAGGILLSLLKTRTPKATVEDKAEPNAEHALDRTSGHPR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0071467 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pH stimulus. pH is a measure of the acidity or basicity of an aqueous solution.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 90 | 108 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 116 | 138 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 237 | 241 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 92 | 109 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 15 | 37 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 31 | 323 | PANTHER | PTHR30238 | MEMBRANE BOUND PREDICTED REDOX MODULATOR |
| 212 | 236 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 143 | 161 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 109 | 114 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 263 | 273 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 16 | 321 | NCBIfam | TIGR03718 | TerC/Alx family metal homeostasis membrane protein |
| 16 | 321 | InterPro | IPR022369 | Integral membrane protein TerC, riboswitch-linked |
| 50 | 72 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 82 | 290 | Pfam | PF03741 | Integral membrane protein TerC family |
| 82 | 290 | InterPro | IPR005496 | Integral membrane protein TerC |
| 115 | 137 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 17 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 39 | 49 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 274 | 293 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 242 | 264 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 162 | 211 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 138 | 142 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 242 | 262 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 269 | 291 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 71 | 89 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 143 | 162 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 319 | 347 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 296 | 318 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 205 | 227 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 299 | 318 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 50 | 70 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 18 | 38 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 294 | 298 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2549
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 5 | 0.727 | ||||||
| 1 | 0.69 |