Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA2556
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA2556
Status: annotated
Amino acids: 361
Structure source: AlphaFold

GO

GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.763

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MKNDGETQASTKGTISVRLVGEALVEWRRQGGEQGEVLQAAGIDPQLLGKPYARVTSHAYSRLWLDLARRMDDEFFGMDSRRLKSGSFAFMSRCAIHEQTLEPALTGILRFLCLQFDDFQPRLQRRGGLAEIVLDEAPGRYGRALSYFTLWMITHGLACWLVGRRIPILAIDLRCPQPDYIEDYRVMFSDNLRFSRPLSRLLFNADCLALPVRRDKRELRRFLLGAPANILVRYRDPQSLAARIKAYLRSLRPGRWPDADALAGHFFMAPSTLRRKLSLEGQSYQALKDQVRRDLAIARLDAGAANFAELALELGFADGSAFHKAFKKWTGSTPGQYRTQVAAETASAESSGVLSETLGHR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4

GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records

Show feature table

Start	End	DB	Term	Name
291	341	SUPERFAMILY	SSF46689	Homeodomain-like
291	341	InterPro	IPR009057	Homeobox-like domain superfamily
242	340	ProSiteProfiles	PS01124	Bacterial regulatory proteins, araC family DNA-binding domain profile.
242	340	InterPro	IPR018060	DNA binding HTH domain, AraC-type
11	345	PANTHER	PTHR47894	HTH-TYPE TRANSCRIPTIONAL REGULATOR GADX
322	338	PRINTS	PR00032	AraC bacterial regulatory protein HTH signature
322	338	InterPro	IPR020449	Transcription regulator HTH, AraC- type
307	322	PRINTS	PR00032	AraC bacterial regulatory protein HTH signature
307	322	InterPro	IPR020449	Transcription regulator HTH, AraC- type
31	212	Pfam	PF12625	Arabinose-binding domain of AraC transcription regulator, N-term
31	212	InterPro	IPR032687	HTH-type transcriptional regulator AraC-type, N-terminal
255	338	SMART	SM00342	aracneu4
255	338	InterPro	IPR018060	DNA binding HTH domain, AraC-type
236	351	Gene3D	G3DSA:1.10.10.60	-
262	339	Pfam	PF12833	Helix-turn-helix domain
262	339	InterPro	IPR018060	DNA binding HTH domain, AraC-type

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2556	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
4				0.763
10				0.331

PA2556