Protein profile

PA2568

hypothetical protein

Genome: NC_002516.2

Gene: PA2568 Structure source: AlphaFold UniProt Q9I0R7
Amino acids 135
Annotations 0
Features 10
PDB binders 0
Druggability 0.753

Overview

Basic information about this protein and its source genome.

Accession
PA2568
Gene
PA2568
Status
annotated
Amino acids
135
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.753
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MEHPYKTPEADLADERLTAGGFLSGGQPLWKAFWLFFAAGFLLLSVAARQAMVAIVDPLMQEAPGEHAVALTLWGMVGVELVRLAYLCLSLVVVWRCGRNSRWVAARHASRAVLLALILLTLYSIYLVWALLASP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
133 135 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
112 134 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
112 132 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
33 55 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
57 67 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
32 56 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 31 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
93 111 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
70 92 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
68 92 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2568
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.753
5 0.562
2 0.475