Protein profile

PA2580

hypothetical protein

Genome: NC_002516.2

Gene: PA2580 Structure source: AlphaFold UniProt Q9I0Q6
Amino acids 196
Annotations 5
Features 7
PDB binders 1
Druggability 0.664

Overview

Basic information about this protein and its source genome.

Accession
PA2580
Gene
PA2580
Status
annotated
Amino acids
196
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.664
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKNILLLNGGKRFAHSDGRLNQTLHETALAHLDRRGFDLRQTFIDGGYDIPTEVDKFLWADVVIYQMPGWWMGAPWTVKRYIDEVFTAGHGSLYANDGRTRSDSTQKYGSGGLVQGKRYMISATWNAPRQAFDDPSDFFEGKGVDAVYFPFHKANQFLGMSGLPTFLAVDVMKRPDVPATVAAYQAHLDRVFGRAG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0003955 Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a quinol.
  • GO:0008753 Catalysis of the reaction: NADPH + H+ + a quinone = NADP+ + a quinol.
  • GO:0034599 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.

Sequence Features

Domain/signature hits from InterPro and related databases.

7 records
Show feature table
Start End DB Term Name
2 188 Pfam PF02525 Flavodoxin-like fold
2 188 InterPro IPR003680 Flavodoxin-like fold
1 193 FunFam G3DSA:3.40.50.360:FF:000007 Drug activity modulator B
1 193 Gene3D G3DSA:3.40.50.360 -
1 193 InterPro IPR029039 Flavoprotein-like superfamily
2 192 PANTHER PTHR46305 -
1 193 SUPERFAMILY SSF52218 Flavoproteins

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2580
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.647
3 0.455

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

20 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
VK3 Q8DTD1 172.2 Da LogP 2.01 TPSA 34.1 ✓ Ro5 Alert CC1=CC(=O)c2ccccc2C1=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.