Protein profile

PA2595

hypothetical protein

Genome: NC_002516.2

Gene: PA2595 Structure source: AlphaFold UniProt Q9I0P2
Export view
Amino acids 318
Annotations 2
Features 19
PDB binders 0
Druggability 0.76

Overview

Basic information about this protein and its source genome.

Accession
PA2595
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA2595
Status
annotated
Amino acids
318
Structure source
AlphaFold
GO
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it. GO:0042626 Primary active transporter of a solute across a membrane, via the reaction: ATP + H2O = ADP + phosphate, to directly drive the transport of a substance across a membrane. The transport protein may be transiently phosphorylated (P-type transporters), or not (ABC-type transporters and other families of transporters). Primary active transport occurs up the solute's concentration gradient and is driven by a primary energy source.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.76
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MRQTLSLFLLLCLLVGQACADERVTLRLADQKGNMRAQLEAAGALDDLTYDIRWFEFPAAAPLAEALNAGAVDAGIIGDAPLLFALAAGARLKAIAVDKSDPYGTAVLVRGDSPLRSANDLKGQRIATGRGSIGHFVALKALASVGLGEKDVEFRFLGPVDAKMALANGSVDAWATWEPYTAFAETADKARVLVDGRGLWAGNSFLAATDSALADPAKRAVLQDYLQRLASAQRWAYLHLDEYSRSLAQIIGFPEDAARLQFERRRLRWQALDERTLGQQQETADFYQAHGLIPQRLDVRPTFASGFAVRQASDADIR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0042626 Primary active transporter of a solute across a membrane, via the reaction: ATP + H2O = ADP + phosphate, to directly drive the transport of a substance across a membrane. The transport protein may be transiently phosphorylated (P-type transporters), or not (ABC-type transporters and other families of transporters). Primary active transport occurs up the solute's concentration gradient and is driven by a primary energy source.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
102 201 Gene3D G3DSA:3.40.190.10 -
1 20 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
25 291 CDD cd13558 PBP2_SsuA_like_2
16 20 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 20 SignalP_EUK SignalP-noTM SignalP-noTM
29 299 Gene3D G3DSA:3.40.190.10 -
102 201 FunFam G3DSA:3.40.190.10:FF:000050 Sulfonate ABC transporter substrate-binding protein
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
55 251 Pfam PF13379 NMT1-like family
24 243 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
21 318 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 19 ProSiteProfiles PS51257 Prokaryotic membrane lipoprotein lipid attachment site profile.
25 239 SMART SM00062 AABind_6
25 239 InterPro IPR001638 Solute-binding protein family 3/N-terminal domain of MltF
27 305 NCBIfam TIGR01728 aliphatic sulfonate ABC transporter substrate-binding protein
27 305 InterPro IPR010067 Aliphatic sulfonates-binding protein
5 296 PANTHER PTHR30024 ALIPHATIC SULFONATES-BINDING PROTEIN-RELATED
1 20 Phobius SIGNAL_PEPTIDE Signal peptide region
4 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2595
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.76