Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA2596
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA2596
Status: annotated
Amino acids: 328
Structure source: AlphaFold

GO

GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it. GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria). GO:0042626 Primary active transporter of a solute across a membrane, via the reaction: ATP + H2O = ADP + phosphate, to directly drive the transport of a substance across a membrane. The transport protein may be transiently phosphorylated (P-type transporters), or not (ABC-type transporters and other families of transporters). Primary active transport occurs up the solute's concentration gradient and is driven by a primary energy source.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.679

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MKRPLCVLAGLLAATLLAGAASAADLISLRLGDVKGDRYAALRASGELDDLPYKLEMSAFPSGAPVLEALNAGALDIGFTGDIPFLFVYAAGAPLKAVGAWHFNPATVALVVGKDSPIRSVAGLKGKRIAVNRGGWGHFLALGALRRAGLGPQDVSFSFLGPVDGRAALVRGSVDAWVPWEPYTSSAVLLDQARVIDNGAGIMTGYSYALASDAAIARKKAAISDLLTRLARAQAWALRHPEAFAEALAKDLNMPREVTRRWVGEARISPVVFGPEVAATLQTAADFFHAEGVLPKSLEVAPAFDFSLSAGAAEVARQLPADLRVGQR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3

GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
GO:0042626 Primary active transporter of a solute across a membrane, via the reaction: ATP + H2O = ADP + phosphate, to directly drive the transport of a substance across a membrane. The transport protein may be transiently phosphorylated (P-type transporters), or not (ABC-type transporters and other families of transporters). Primary active transport occurs up the solute's concentration gradient and is driven by a primary energy source.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records

Show feature table

Start	End	DB	Term	Name
1	23	SignalP_GRAM_NEGATIVE	SignalP-noTM	SignalP-noTM
7	29	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	23	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
24	328	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
29	292	CDD	cd13558	PBP2_SsuA_like_2
5	18	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
4	305	PANTHER	PTHR30024	ALIPHATIC SULFONATES-BINDING PROTEIN-RELATED
105	204	FunFam	G3DSA:3.40.190.10:FF:000050	Sulfonate ABC transporter substrate-binding protein
105	204	Gene3D	G3DSA:3.40.190.10	-
1	23	Phobius	SIGNAL_PEPTIDE	Signal peptide region
32	300	Gene3D	G3DSA:3.40.190.10	-
64	243	Pfam	PF09084	NMT1/THI5 like
64	243	InterPro	IPR015168	SsuA/THI5-like
1	4	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
29	309	NCBIfam	TIGR01728	aliphatic sulfonate ABC transporter substrate-binding protein
29	309	InterPro	IPR010067	Aliphatic sulfonates-binding protein
39	254	SUPERFAMILY	SSF53850	Periplasmic binding protein-like II
28	240	SMART	SM00062	AABind_6
28	240	InterPro	IPR001638	Solute-binding protein family 3/N-terminal domain of MltF
19	23	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2596	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.679

PA2596