Overview
Basic information about this protein and its source genome.
- Accession
- PA2596
- Gene
- PA2596
- Status
- annotated
- Amino acids
- 328
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKRPLCVLAGLLAATLLAGAASAADLISLRLGDVKGDRYAALRASGELDDLPYKLEMSAFPSGAPVLEALNAGALDIGFTGDIPFLFVYAAGAPLKAVGAWHFNPATVALVVGKDSPIRSVAGLKGKRIAVNRGGWGHFLALGALRRAGLGPQDVSFSFLGPVDGRAALVRGSVDAWVPWEPYTSSAVLLDQARVIDNGAGIMTGYSYALASDAAIARKKAAISDLLTRLARAQAWALRHPEAFAEALAKDLNMPREVTRRWVGEARISPVVFGPEVAATLQTAADFFHAEGVLPKSLEVAPAFDFSLSAGAAEVARQLPADLRVGQR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
- GO:0042626 Primary active transporter of a solute across a membrane, via the reaction: ATP + H2O = ADP + phosphate, to directly drive the transport of a substance across a membrane. The transport protein may be transiently phosphorylated (P-type transporters), or not (ABC-type transporters and other families of transporters). Primary active transport occurs up the solute's concentration gradient and is driven by a primary energy source.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 23 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 7 | 29 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 23 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 24 | 328 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 29 | 292 | CDD | cd13558 | PBP2_SsuA_like_2 |
| 5 | 18 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 4 | 305 | PANTHER | PTHR30024 | ALIPHATIC SULFONATES-BINDING PROTEIN-RELATED |
| 105 | 204 | FunFam | G3DSA:3.40.190.10:FF:000050 | Sulfonate ABC transporter substrate-binding protein |
| 105 | 204 | Gene3D | G3DSA:3.40.190.10 | - |
| 1 | 23 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 32 | 300 | Gene3D | G3DSA:3.40.190.10 | - |
| 64 | 243 | Pfam | PF09084 | NMT1/THI5 like |
| 64 | 243 | InterPro | IPR015168 | SsuA/THI5-like |
| 1 | 4 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 29 | 309 | NCBIfam | TIGR01728 | aliphatic sulfonate ABC transporter substrate-binding protein |
| 29 | 309 | InterPro | IPR010067 | Aliphatic sulfonates-binding protein |
| 39 | 254 | SUPERFAMILY | SSF53850 | Periplasmic binding protein-like II |
| 28 | 240 | SMART | SM00062 | AABind_6 |
| 28 | 240 | InterPro | IPR001638 | Solute-binding protein family 3/N-terminal domain of MltF |
| 19 | 23 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2596
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.679 |