Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA2604
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA2604
Status: annotated
Amino acids: 222
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0005262 Enables the energy-independent facilitated diffusion of a calcium ion through a transmembrane aqueous pore or channel. GO:0030162 Any process that modulates the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it. GO:0043066 Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.

Target profile

Computed evidence for target prioritization.

Human off-target: hit
Human identity (%): 36.607
Human E-value: 6.53e-09
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.734

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MQEQQYQLNSAVAEQREVSGVLRNTYGLLALTLAFSGLVAYVSQQMRLPYPNVFVVLIGFYGLFFLTVKLRNSAWGLVSTFALTGFMGYTLGPILNMYLGLPNGGSVITSAFAMTALVFFGLSAYVLTTRKDMSFLSGFITAGFFVLLGAVLVSLFFQISGLQLAISAGFVLFSSAMILYQTSAIIHGGERNYIMATISLYVSIYNLFISLLQIFGIAGGDD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0005262 Enables the energy-independent facilitated diffusion of a calcium ion through a transmembrane aqueous pore or channel.
GO:0030162 Any process that modulates the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
GO:0043066 Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.

Sequence Features

Domain/signature hits from InterPro and related databases.

29 records

Show feature table

Start	End	DB	Term	Name
107	128	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
17	220	CDD	cd10433	YccA_like
69	74	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
219	222	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
21	215	Pfam	PF01027	Inhibitor of apoptosis-promoting Bax1
21	215	InterPro	IPR006214	Bax inhibitor 1-related
157	161	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
192	218	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
181	191	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
105	127	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
73	95	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
75	95	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
88	119	ProSitePatterns	PS01243	Bax inhibitor-1 family signature.
88	119	InterPro	IPR006213	Bax inhibitor 1, conserved site
20	42	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
162	180	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
135	156	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
129	134	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
48	68	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
9	216	PANTHER	PTHR23291	BAX INHIBITOR-RELATED
9	216	InterPro	IPR006214	Bax inhibitor 1-related
21	42	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
46	68	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
96	106	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	20	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
134	156	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
166	188	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
43	47	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
195	217	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2604	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.734
6				0.207

PA2604