Overview
Basic information about this protein and its source genome.
- Accession
- PA2607
- Gene
- PA2607
- Status
- annotated
- Amino acids
- 101
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MATTLHVLSRSPFNDGRLGSCLYLLNPGDGLLLCGDAVHALLAGSHACQALELMPAEIELFALLEDLQARGIEDVPARLVAVDYPGFVELATRFDKVNSWL
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:1990228 A protein complex capable of catalyzing the transfer of sulfur atoms from one compound (donor) to another (acceptor).
- GO:0002143 The process in which a uridine residue at position 34 in the anticodon of a tRNA is post-transcriptionally thiolated at the C2 position. This process involves transfer of a sulfur from cysteine to position C2 by several steps.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 100 | SUPERFAMILY | SSF75169 | DsrEFH-like |
| 4 | 100 | InterPro | IPR027396 | DsrEFH-like |
| 4 | 100 | Gene3D | G3DSA:3.40.1260.10 | - |
| 10 | 97 | Pfam | PF04077 | DsrH like protein |
| 10 | 97 | InterPro | IPR007215 | Sulphur relay, TusB/DsrH |
| 4 | 100 | FunFam | G3DSA:3.40.1260.10:FF:000005 | Sulfur relay protein DsrH |
| 2 | 100 | PANTHER | PTHR37526 | PROTEIN TUSB |
| 2 | 100 | InterPro | IPR007215 | Sulphur relay, TusB/DsrH |
| 5 | 100 | NCBIfam | TIGR03011 | sulfurtransferase complex subunit TusB |
| 5 | 100 | InterPro | IPR007215 | Sulphur relay, TusB/DsrH |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2607
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.66 |