Protein profile

PA2608

hypothetical protein

Genome: NC_002516.2

Gene: PA2608 Structure source: AlphaFold UniProt Q9I0N0
Amino acids 111
Annotations 5
Features 15
PDB binders 1
Druggability 0.737

Overview

Basic information about this protein and its source genome.

Accession
PA2608
Gene
PA2608
Status
annotated
Amino acids
111
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.737
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTLLMLEGREIRLDKDGYLAALDDWSEPVAEALAAREELALTAEHWEILQLLREFYAEFQLSPANRPLIKYVAQRLGPDKGNSLHLNHLFKGAPAKLGAKLAGLPKPSNCL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0097163 Covalently binding to sulfur and delivering it to an acceptor molecule.
  • GO:0016740 Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
  • GO:0002143 The process in which a uridine residue at position 34 in the anticodon of a tRNA is post-transcriptionally thiolated at the C2 position. This process involves transfer of a sulfur from cysteine to position C2 by several steps.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
5 111 NCBIfam TIGR03342 TusE/DsrC/DsvC family sulfur relay protein
5 111 InterPro IPR007453 Sulphur transfer protein DsrC/TusE
41 111 Gene3D G3DSA:1.10.10.370 -
41 111 InterPro IPR042072 DsrC-like protein, C-terminal domain
7 111 Pfam PF04358 DsrC like protein
7 111 InterPro IPR007453 Sulphur transfer protein DsrC/TusE
4 111 PIRSF PIRSF006223 DsrC_TusE
4 111 InterPro IPR007453 Sulphur transfer protein DsrC/TusE
4 39 Gene3D G3DSA:3.30.1420.10 -
4 39 InterPro IPR043163 DsrC-like protein, N-terminal domain
2 111 SUPERFAMILY SSF69721 DsrC, the gamma subunit of dissimilatory sulfite reductase
2 111 InterPro IPR025526 DsrC-like domain superfamily
3 111 PANTHER PTHR37010 SULFURTRANSFERASE TUSE
3 111 InterPro IPR007453 Sulphur transfer protein DsrC/TusE
41 111 FunFam G3DSA:1.10.10.370:FF:000002 Sulfurtransferase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2608
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.737

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

1 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
SH0 P45573 868.9 Da LogP 3.40 TPSA 347.2 3 viol. ✓ Clean C[C@@]\1([C@@H](C2/C=C\3/[C@@]([C@@H](/C(=C/C4=…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.