Protein profile

PA2616

thioredoxin reductase

Genome: NC_002516.2

Gene: trxB1 PA2616 Structure source: AlphaFold UniProt Q9I0M2
Amino acids 316
Annotations 6
Features 27
PDB binders 4
Druggability 0.728

Overview

Basic information about this protein and its source genome.

Accession
PA2616
Gene
trxB1 PA2616
Status
annotated
Amino acids
316
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.728
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSEVKHSRLIILGSGPAGYTAAVYAARANLKPVVITGIQPGGQLTTTTEVDNWPGDVEGLTGPALMTRMQQHAERFDTEIVYDHIHTAELQQRPFTLKGDSGTYTCDALIIATGASAQYLGMSSEEAFMGKGVSACATCDGFFYRNQVVCVVGGGNTAVEEALYLANIAKEVHLIHRRDKLRSEKILQDKLFDKAENGNVHLHWNTTLDEVLGDASGVTGVRLKSTIDGSTSELSLAGVFIAIGHKPNTDLFQGQLEMRDGYLRIHGGSEGNATQTSIEGVFAAGDVADHVYRQAITSAGAGCMAALDAEKYLDDH

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0004791 Catalysis of the reaction: thioredoxin-dithiol + NADP+ = thioredoxin-disulfide + H+ + NADPH.
  • GO:0045454 Any process that maintains the redox environment of a cell or compartment within a cell.
  • GO:0019430 Any process, acting at the cellular level, involved in removing superoxide radicals (O2-) from a cell or organism, e.g. by conversion to dioxygen (O2) and hydrogen peroxide (H2O2).
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
2 313 SUPERFAMILY SSF51905 FAD/NAD(P)-binding domain
2 313 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
118 244 Gene3D G3DSA:3.50.50.60 -
118 244 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
6 314 PANTHER PTHR48105 THIOREDOXIN REDUCTASE 1-RELATED-RELATED
129 141 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
62 72 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
107 115 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
199 215 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
238 259 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
41 56 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
276 294 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
8 30 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
144 168 PRINTS PR00469 Pyridine nucleotide disulphide reductase class-II signature
266 288 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
106 124 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
236 252 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
148 166 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
9 28 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
136 156 ProSitePatterns PS00573 Pyridine nucleotide-disulphide oxidoreductases class-II active site.
136 156 InterPro IPR008255 Pyridine nucleotide-disulphide oxidoreductase, class-II, active site
9 313 Gene3D G3DSA:3.50.50.60 -
9 313 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
8 313 NCBIfam TIGR01292 thioredoxin-disulfide reductase
8 313 InterPro IPR005982 Thioredoxin reductase
8 300 Pfam PF07992 Pyridine nucleotide-disulphide oxidoreductase
8 300 InterPro IPR023753 FAD/NAD(P)-binding domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2616
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.728

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

70 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3AA P0A9P4 716.4 Da LogP -2.42 TPSA 347.7 3 viol. ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…
FDA Q8YID2 787.6 Da LogP -1.75 TPSA 363.3 3 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=C(N2)C(=O)NC(=O)N3)C[C@@H]([C…
MLI A0A229Y1X4 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
MLT A0A229Y1X4 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.