Protein profile

PA2662

hypothetical protein

Genome: NC_002516.2

Gene: PA2662 Structure source: AlphaFold UniProt Q9I0H6
Amino acids 397
Annotations 0
Features 39
PDB binders 0
Druggability 0.699

Overview

Basic information about this protein and its source genome.

Accession
PA2662
Gene
PA2662
Status
annotated
Amino acids
397
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.699
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MQVLDRSRLMAIPPIWRLGFRPFFLGGALFAVLAIALWLAALAGLWSGWQPVGGWLAWHRHEMLFGFGVAIIAGFLLTAVQTWTGVPGLQGKPLALLAGLWLAARLAWLFDAPLALLLVLQLSFLPLLAWAIGRSLWRVRQKRNYPVVGLLLLLTLADALVLLGLFEGNDDWQRRASIAALWLIAGMMNLIGGRVIPFFTQRGLGRQQQVPAIAWLDNGILLGCVLVALLTAAGVTTQPTPWLAGLFAALGGAQLWRLWRWRDRGIWQVPLLWSLHLAYFWIAVAPLGMALWSLGLALAPSQALHALAVGGMGGLILAMLARVTLGHTGRALQPPAAMPWAFALLNLGCAARVFLPSLLPANWALPLAGGLWALAFLLFAWFYAPMLCRPRVDGHPG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

39 records
Show feature table
Start End DB Term Name
304 325 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
337 359 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 19 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
167 177 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
178 200 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
385 397 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
212 235 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
87 92 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
145 166 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
271 293 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
20 43 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
303 325 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
242 259 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
210 232 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
63 86 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
111 115 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
93 110 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
144 166 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
326 336 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
176 198 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
271 292 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
27 49 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
236 240 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
93 110 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
44 62 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
14 391 Pfam PF05940 NnrS protein
14 391 InterPro IPR010266 NnrS
260 270 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
293 303 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
241 259 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
356 360 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
363 385 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
115 137 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
201 211 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
116 133 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
361 384 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
337 355 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
64 86 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
134 144 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2662
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.699
17 0.468