Overview
Basic information about this protein and its source genome.
- Accession
- PA2707
- Gene
- PA2707
- Status
- annotated
- Amino acids
- 281
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- hit
- Human identity (%)
- 26.667
- Human E-value
- 7.7e-06
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKFEGTQSYVATDDLKLAVNAAITLQRPLLVKGEPGTGKTMLAEQLAESFGAKLITWHIKSTTKAHQGLYEYDAVSRLRDSQLGVDKVHDVRNYIKKGKLWEAFEAEERVILLIDEIDKADIEFPNDLLQELDKMEFYVYETNETIKAKQRPIIIITSNNEKELPDAFLRRCFFHYIAFPDRETLQKIVDVHYPNIKQSLVSEALDIFFDVRKVPGLKKKPSTSELVDWLKLLMADEIGEAVLRERDPTKAIPPLAGALVKNEQDVQLLERLAFMSRRASR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 27 | 180 | CDD | cd00009 | AAA |
| 25 | 183 | SMART | SM00382 | AAA_5 |
| 25 | 183 | InterPro | IPR003593 | AAA+ ATPase domain |
| 1 | 207 | Gene3D | G3DSA:3.40.50.300 | - |
| 1 | 207 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
| 29 | 173 | Pfam | PF00004 | ATPase family associated with various cellular activities (AAA) |
| 29 | 173 | InterPro | IPR003959 | ATPase, AAA-type, core |
| 8 | 249 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases |
| 8 | 249 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
| 3 | 194 | PANTHER | PTHR42759 | MOXR FAMILY PROTEIN |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2707
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.748 |