Protein profile

PA2711

spermidine/putrescine-binding protein

Genome: NC_002516.2

Gene: PA2711 Structure source: AlphaFold UniProt Q9I0D1
Amino acids 363
Annotations 7
Features 37
PDB binders 11
Druggability 0.632

Overview

Basic information about this protein and its source genome.

Accession
PA2711
Gene
PA2711
Status
annotated
Amino acids
363
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.632
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKTRIASLTLLALACGSGATLAADNLKIYNWSEYIAPETVANFAKETGIQATYDVYDSNETLDGKLMTGQSGYDVVFPSNHFMAKQIQAGALKKLDKSRLPNWKNLNPVLLKALEVNDPGNQYGFPYLWGTTGIGYNPAKIKAVLGDDAPLDSWDIFFKPEYMQKLSKCGVAVLDNGPELLPITLNYLGLPHHSQKADDYKQAQAALLKVRPYIRYFHSSKYVSDLANGEICMVVGFSGDILQAATRAKEANNGVEVRYSTPKEGSPLWFDMVSMPVDAPDEKAGYAFMNYLLRPEVMAAISNHVHYANGNLAADPLVDAEIKADPAIYPPQEKMAKLFALESMPQKIDRVRTRTWNTVKTGK

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Gene Ontology (GO)

7
  • GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
  • GO:0019810 Binding to putrescine, 1,4-diaminobutane, the polyamine formed by decarboxylation of ornithine and the metabolic precursor of spermidine and spermine.
  • GO:0019809 Binding to spermidine, N-(3-aminopropyl)-1,4-diaminobutane.
  • GO:0015847 The directed movement of putrescine into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Putrescine is 1,4-diaminobutane, the polyamine formed by decarboxylation of ornithine and the metabolic precursor of spermidine and spermine.
  • GO:0015846 The directed movement of polyamines, organic compounds containing two or more amino groups, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
  • GO:0019808 Binding to a polyamine, an organic compound containing two or more amino groups.

Sequence Features

Domain/signature hits from InterPro and related databases.

37 records
Show feature table
Start End DB Term Name
1 22 Phobius SIGNAL_PEPTIDE Signal peptide region
1 22 SignalP_EUK SignalP-noTM SignalP-noTM
130 357 Gene3D G3DSA:3.40.190.10 -
5 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
26 329 Gene3D G3DSA:3.40.190.10 -
39 328 Pfam PF13416 Bacterial extracellular solute-binding protein
39 328 InterPro IPR006059 Bacterial extracellular solute-binding protein
23 363 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
16 22 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 15 ProSiteProfiles PS51257 Prokaryotic membrane lipoprotein lipid attachment site profile.
1 22 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
26 362 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
29 45 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
29 45 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
175 194 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
175 194 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
262 281 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
262 281 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
307 333 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
307 333 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
152 166 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
152 166 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
212 231 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
212 231 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
45 66 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
45 66 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
72 86 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
72 86 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
88 101 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
88 101 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
121 137 PRINTS PR00909 Bacterial periplasmic spermidine/putrescine-binding protein signature
121 137 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
26 356 CDD cd13659 PBP2_PotF
1 363 PIRSF PIRSF019574 Periplasmic_polyamine_BP
1 363 InterPro IPR001188 Spermidine/putrescine-binding periplasmic protein
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
8 359 PANTHER PTHR30222 SPERMIDINE/PUTRESCINE-BINDING PERIPLASMIC PROTEIN

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2711
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.632

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

61 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AG2 P31133 130.2 Da LogP -0.79 TPSA 87.9 ✓ Ro5 ✓ Clean C(CCNC(=N)N)CN
JFN P31133 89.1 Da LogP -0.02 TPSA 35.2 ✓ Ro5 ✓ Clean C[C@H](COC)N
MLI P31133 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
N2P P31133 102.2 Da LogP 0.07 TPSA 52.0 ✓ Ro5 ✓ Clean C(CCN)CCN
ONT P31133 133.2 Da LogP -0.00 TPSA 44.5 ✓ Ro5 ✓ Clean C[C@@H](COCCOC)N
ONW P31133 191.3 Da LogP 0.40 TPSA 53.7 ✓ Ro5 ✓ Clean C[C@H](CO[C@H](C)COCCOC)N
P33 P31133 326.4 Da LogP -0.93 TPSA 95.8 ✓ Ro5 ✓ Clean C(COCCOCCOCCOCCOCCOCCO)O
PUT P31133 88.2 Da LogP -0.32 TPSA 52.0 ✓ Ro5 ✓ Clean C(CCN)CN
SPD P0AFK9 145.2 Da LogP -0.34 TPSA 64.1 ✓ Ro5 ✓ Clean C(CCNCCCN)CN
SPM P31133 202.3 Da LogP -0.36 TPSA 76.1 ✓ Ro5 ✓ Clean C(CCNCCCN)CNCCCN
TAM P31133 163.2 Da LogP -1.17 TPSA 86.7 ✓ Ro5 ✓ Clean C(CO)C(CCO)(CCO)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.