Protein profile

PA2715

ferredoxin

Genome: NC_002516.2

Gene: PA2715 Structure source: AlphaFold UniProt Q9I0C7
Amino acids 112
Annotations 4
Features 19
PDB binders 1
Druggability 0.678

Overview

Basic information about this protein and its source genome.

Accession
PA2715
Gene
PA2715
Status
annotated
Amino acids
112
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.678
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTFVVLEECIRCKHTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPVAAIRAEDEVPLGQRQFIALNGELAAHPNWTQITRKKPAPDDHDAWFGLPGKLAELDRNGA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0051538 Binding to a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
  • GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
  • GO:0046872 Binding to a metal ion.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
3 58 PANTHER PTHR42859 OXIDOREDUCTASE
35 52 PRINTS PR00354 7Fe ferredoxin signature
35 52 InterPro IPR000813 7Fe ferredoxin
19 29 PRINTS PR00354 7Fe ferredoxin signature
19 29 InterPro IPR000813 7Fe ferredoxin
9 19 PRINTS PR00354 7Fe ferredoxin signature
9 19 InterPro IPR000813 7Fe ferredoxin
1 30 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
1 30 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
66 109 Pfam PF11953 Domain of unknown function (DUF3470)
66 109 InterPro IPR022569 Ferredoxin, C-terminal
34 56 Pfam PF00037 4Fe-4S binding domain
34 56 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
40 51 ProSitePatterns PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.
40 51 InterPro IPR017900 4Fe-4S ferredoxin, iron-sulphur binding, conserved site
2 109 Gene3D G3DSA:3.30.70.20 -
31 60 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
31 60 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
3 101 SUPERFAMILY SSF54862 4Fe-4S ferredoxins

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2715
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.678
2 0.318

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

1 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
F3S P00214 295.8 Da LogP 2.59 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]2S[Fe]3[S]2[Fe]1S3

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.