Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA2738
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA2738 ihfA himA
Status: annotated
Amino acids: 100
Structure source: AlphaFold

GO

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. GO:0032993 A macromolecular complex containing both protein and DNA molecules. GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0001216 A DNA-binding transcription factor activity that activates or increases transcription of specific gene sets. GO:0030527 The action of a molecule that contributes to the structural integrity of chromatin. GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.749

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MGALTKAEIAERLYEELGLNKREAKELVELFFEEIRQALEHNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIPITARRVVTFRPGQKLKARVEAYAGTKS

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

10 GO

Gene Ontology (GO)

10

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
GO:0032993 A macromolecular complex containing both protein and DNA molecules.
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
GO:0001216 A DNA-binding transcription factor activity that activates or increases transcription of specific gene sets.
GO:0030527 The action of a molecule that contributes to the structural integrity of chromatin.
GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
GO:0006310 Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
GO:0045893 Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
GO:0006417 Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

26 records

Show feature table

Start	End	DB	Term	Name
43	58	PRINTS	PR01727	Prokaryotic integration host factor signature
43	58	InterPro	IPR000119	Histone-like DNA-binding protein
61	74	PRINTS	PR01727	Prokaryotic integration host factor signature
61	74	InterPro	IPR000119	Histone-like DNA-binding protein
77	91	PRINTS	PR01727	Prokaryotic integration host factor signature
77	91	InterPro	IPR000119	Histone-like DNA-binding protein
4	93	SMART	SM00411	bhlneu
4	93	InterPro	IPR000119	Histone-like DNA-binding protein
4	92	Pfam	PF00216	Bacterial DNA-binding protein
4	92	InterPro	IPR000119	Histone-like DNA-binding protein
5	92	CDD	cd13835	IHF_A
5	92	InterPro	IPR005684	Integration host factor, alpha subunit
2	98	Hamap	MF_00380	Integration host factor subunit alpha [ihfA].
2	98	InterPro	IPR005684	Integration host factor, alpha subunit
3	96	Gene3D	G3DSA:4.10.520.10	-
3	96	InterPro	IPR010992	Integration host factor (IHF)-like DNA-binding domain superfamily
1	94	PANTHER	PTHR33175	DNA-BINDING PROTEIN HU
1	94	InterPro	IPR000119	Histone-like DNA-binding protein
3	97	NCBIfam	TIGR00987	integration host factor subunit alpha
3	97	InterPro	IPR005684	Integration host factor, alpha subunit
2	99	FunFam	G3DSA:4.10.520.10:FF:000002	Integration host factor subunit alpha
4	93	SUPERFAMILY	SSF47729	IHF-like DNA-binding proteins
4	93	InterPro	IPR010992	Integration host factor (IHF)-like DNA-binding domain superfamily
49	68	ProSitePatterns	PS00045	Bacterial histone-like DNA-binding proteins signature.
49	68	InterPro	IPR020816	Histone-like DNA-binding protein, conserved site
7	27	Coils	Coil	Coil

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2738	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.749

PA2738