Protein profile

PA2762

hypothetical protein

Genome: NC_002516.2

Gene: PA2762 Structure source: AlphaFold UniProt Q9I081

Export view

Amino acids 114

Annotations 1

Features 9

PDB binders 0

Druggability 0.687

Overview

Basic information about this protein and its source genome.

Accession: PA2762
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA2762
Status: annotated
Amino acids: 114
Structure source: AlphaFold

GO:0031459 Catalysis of the reaction: ATP + H2O + glycine betaine(out) = ADP + phosphate + glycine betaine(in).

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.687

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSDFITVLRDTCPVPVLDATKWKRIDGDPHTVNLNAYASADGSKLMGTWICTPGKWEVNYERWEFCHFLDGYCIITPEGEQPVHLRAGDVFVIEPGLRGTWEVVETVRKYFVFA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0031459 Catalysis of the reaction: ATP + H2O + glycine betaine(out) = ADP + phosphate + glycine betaine(in).

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records

Show feature table

Start	End	DB	Term	Name
10	113	Gene3D	G3DSA:2.60.120.10	Jelly Rolls
10	113	InterPro	IPR014710	RmlC-like jelly roll fold
39	111	Pfam	PF05899	EutQ-like cupin domain
39	111	InterPro	IPR008579	(S)-ureidoglycine aminohydrolase, cupin domain
14	112	PANTHER	PTHR40943	CYTOPLASMIC PROTEIN-RELATED
10	113	FunFam	G3DSA:2.60.120.10:FF:000179	Cupin domain-containing protein
46	113	CDD	cd02227	cupin_TM1112-like
16	113	SUPERFAMILY	SSF51182	RmlC-like cupins
16	113	InterPro	IPR011051	RmlC-like cupin domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2762	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.687