Protein profile

PA2770

isomerase

Genome: NC_002516.2

Gene: PA2770 Structure source: AlphaFold UniProt Q9I073
Amino acids 259
Annotations 5
Features 11
PDB binders 5
Druggability 0.749

Overview

Basic information about this protein and its source genome.

Accession
PA2770
Gene
PA2770
Status
annotated
Amino acids
259
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
40.339
Human E-value
1.4e-55
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.749
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MELTIFQVDAFADSPFQGNPAAVCPLDAWLDDERLQAIAEENNLSETAFVVGRDGDYRLRWFTPQVEVDLCGHATLATAWVLIHKLDDASPVLRFATRSGELSVRREGDSLAMDFPAKRPEPCATPDGLLEALGIAEAEVLKTDDYLVVVDDEKTIAALAPDFARLKGLPCRGVAVTARSQRFDFVSRWFGPNVGVNEDPVTGSAHTSLAPYWAQRLGKTRLSAEQGGARKGRLECDVRGERVVISGKAALYMSGTLHL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0016853 Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0009058 A cellular process consisting of the biochemical pathways by which a living organism synthesizes chemical substances. This typically represents the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

Sequence Features

Domain/signature hits from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
8 255 Pfam PF02567 Phenazine biosynthesis-like protein
8 255 InterPro IPR003719 Phenazine biosynthesis PhzF-like
117 247 Gene3D G3DSA:3.10.310.10 Diaminopimelate Epimerase; Chain A, domain 1
1 259 SUPERFAMILY SSF54506 Diaminopimelate epimerase-like
6 251 Gene3D G3DSA:3.10.310.10 Diaminopimelate Epimerase; Chain A, domain 1
1 257 NCBIfam TIGR00654 PhzF family phenazine biosynthesis isomerase
1 257 InterPro IPR003719 Phenazine biosynthesis PhzF-like
4 258 PANTHER PTHR13774 PHENAZINE BIOSYNTHESIS PROTEIN
4 258 InterPro IPR003719 Phenazine biosynthesis PhzF-like
1 259 PIRSF PIRSF016184 Ismrse_PhzF
1 259 InterPro IPR003719 Phenazine biosynthesis PhzF-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2770
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.749

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

55 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3HA Q51792 153.1 Da LogP 0.67 TPSA 83.5 ✓ Ro5 ✓ Clean c1cc(c(c(c1)O)N)C(=O)O
BTB Q186X0 209.2 Da LogP -3.01 TPSA 104.4 ✓ Ro5 ✓ Clean C(CO)N(CCO)C(CO)(CO)CO
HHA Q51792 155.2 Da LogP -0.74 TPSA 83.5 ✓ Ro5 ✓ Clean C1=C[C@@H]([C@H](C(=C1)C(=O)O)N)O
SIN A0A6L8PH16 118.1 Da LogP -0.06 TPSA 74.6 ✓ Ro5 ✓ Clean C(CC(=O)O)C(=O)O
W81 Q51792 183.2 Da LogP -1.75 TPSA 77.0 ✓ Ro5 ✓ Clean CCO[C@@H]1C=CC=C([C@H]1[NH3+])C(=O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.