Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA2807
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA2807 copI
Status: annotated
Amino acids: 205
Structure source: AlphaFold

GO

GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria). GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0005507 Binding to a copper (Cu) ion. GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.643

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MLPTASRQAQRHRIGDINPMEIPRMFPRRLLPASLIVLGVLFGASAQASPAHGQAFGKPAQAAQASRSIEVVLGDMYFKPRAIEVKAGETVRFVLKNEGKLLHEFNLGDAAMHAEHQKEMLEMQQSGMLTPTGMASMDHSQMGHGMADMDHGRMMKHDDPNSVLVEPGKSAELTWTFTKATRLEFACNIPGHYQAGMVGQLTVQP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4

GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0005507 Binding to a copper (Cu) ion.
GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records

Show feature table

Start	End	DB	Term	Name
13	205	PANTHER	PTHR38439	AURACYANIN-B
66	204	SUPERFAMILY	SSF49503	Cupredoxins
66	204	InterPro	IPR008972	Cupredoxin
1	53	Phobius	SIGNAL_PEPTIDE	Signal peptide region
52	205	Gene3D	G3DSA:2.60.40.420	-
52	205	InterPro	IPR008972	Cupredoxin
54	109	Pfam	PF13473	Cupredoxin-like domain
54	109	InterPro	IPR028096	EfeO-type cupredoxin-like domain
66	203	CDD	cd04211	Cupredoxin_like_2
54	205	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
30	41	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
52	205	FunFam	G3DSA:2.60.40.420:FF:000191	Uncharacterized protein
1	29	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
42	53	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
153	204	Pfam	PF00127	Copper binding proteins, plastocyanin/azurin family
153	204	InterPro	IPR000923	Blue (type 1) copper domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA2807	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.643
4				0.342

PA2807