Overview
Basic information about this protein and its source genome.
- Accession
- PA2809
- Gene
- PA2809 copR
- Status
- annotated
- Amino acids
- 226
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKLLIVEDEPRIGQYLRQGLAEAGFAVDLSDDGNEGEQLALGGDYDLLILDVMLPGRDGWQILRSVRDAGMTVPVLFLTARDAVEDRVRGLEQGADDYLVKPFAFVELLARVRTLLRRGSQQLQETTLQLADLELDLLRRRVQRQGKRIDLTAKEFALLELLLRRSGEVLPKSLIASQVWDMNFDSDTNVIEVAIRRLRAKVDDDYPQRLIHTVRGMGYVLEERDE
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
8- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0032993 A macromolecular complex containing both protein and DNA molecules.
- GO:0000156 Responds to a phosphorelay sensor to initiate a change in cell state or activity. The activity of the response regulator is regulated by transfer of a phosphate from a histidine residue in the sensor, to an aspartate residue in the response regulator. Many but not all response regulators act as transcriptional regulators to elicit a response.
- GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
- GO:0045892 Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0000160 A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 146 | 221 | SMART | SM00862 | Trans_reg_C_3 |
| 146 | 221 | InterPro | IPR001867 | OmpR/PhoB-type DNA-binding domain |
| 1 | 80 | FunFam | G3DSA:3.40.50.2300:FF:000002 | DNA-binding response regulator PhoP |
| 116 | 136 | Coils | Coil | Coil |
| 133 | 221 | CDD | cd00383 | trans_reg_C |
| 133 | 221 | InterPro | IPR001867 | OmpR/PhoB-type DNA-binding domain |
| 3 | 221 | NCBIfam | TIGR01387 | heavy metal response regulator transcription factor |
| 3 | 221 | InterPro | IPR006291 | Transcriptional regulatory protein CusR-like, heavy metal response |
| 119 | 225 | Gene3D | G3DSA:1.10.10.10 | - |
| 119 | 225 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 81 | 118 | Gene3D | G3DSA:6.10.250.690 | - |
| 125 | 223 | ProSiteProfiles | PS51755 | OmpR/PhoB-type DNA-binding domain profile. |
| 125 | 223 | InterPro | IPR001867 | OmpR/PhoB-type DNA-binding domain |
| 146 | 221 | Pfam | PF00486 | Transcriptional regulatory protein, C terminal |
| 2 | 116 | ProSiteProfiles | PS50110 | Response regulatory domain profile. |
| 2 | 116 | InterPro | IPR001789 | Signal transduction response regulator, receiver domain |
| 122 | 223 | FunFam | G3DSA:1.10.10.10:FF:000005 | Two-component system response regulator |
| 1 | 175 | SUPERFAMILY | SSF52172 | CheY-like |
| 1 | 175 | InterPro | IPR011006 | CheY-like superfamily |
| 1 | 223 | PANTHER | PTHR48111 | REGULATOR OF RPOS |
| 1 | 223 | InterPro | IPR039420 | Transcriptional regulatory protein WalR-like |
| 1 | 80 | Gene3D | G3DSA:3.40.50.2300 | - |
| 1 | 112 | SMART | SM00448 | REC_2 |
| 1 | 112 | InterPro | IPR001789 | Signal transduction response regulator, receiver domain |
| 3 | 102 | CDD | cd19935 | REC_OmpR_CusR-like |
| 4 | 112 | Pfam | PF00072 | Response regulator receiver domain |
| 4 | 112 | InterPro | IPR001789 | Signal transduction response regulator, receiver domain |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2809
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.743 | ||||||
| 3 | 0.319 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
No virtual-screening candidates for this protein.
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.